KEGG   Arabidopsis thaliana (thale cress): AT1G80310Help
Entry
AT1G80310         CDS       T00041                                 

Gene name
MOT2
Definition
(RefSeq) sulfate transmembrane transporter
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: MFS_MOT1 Sulfate_transp
Motif
Other DBs
NCBI-GeneID: 844371
NCBI-ProteinID: NP_178147
MIPS: AT1G80310.1
TAIR: AT1G80310
Araport: AT1G80310
UniProt: Q0WP36 A0A178WGR3
Position
1
AA seq 464 aa AA seqDB search
METTTTPLLPGDRSRCGWLRRRLRLKNPLSSELSGAVGDLGTFIPIVLTLTLVSNLDLST
TLIFTGFYNIATGLLFDIPMPVQPMKSIAAVAVSESPHLTPSQIAAAGASTAATLLLLGA
TGAMSFLYNIIPLPVVRGVQLSQGLQFAFTAIKYVRFNYDTATLKPSSSPRIWLGLDGLI
LALAALLFIILSTGSGNDREAEDGDLAETSSNESQSRRRRLRLLSSIPSALIVFALGLVL
CFIRDPSIFKDLKFGPSKFHILRISWDDWKIGFLRAAIPQIPLSVLNSVIAVCKLSNDLF
DKELSATTVSISVGVMNLIGCWFGAMPVCHGAGGLAGQYRFGARSGLSVIFLGIGKLIVG
LVFGNSFVRILSQFPIGILGVLLLFAGIELAMASKDMNSKEDSFIMLVCAAVSMTGSSAA
LGFGCGVVLYLLLKLRTLDCSSVTLFSRSSDESQVDSEAAPRDV
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atggagacaactacaactcctctgctccccggtgatcgcagcagatgcgggtggctccgt
cgccgtctccgcctcaaaaaccctctttcttctgaactctccggcgctgtcggtgatctc
ggcaccttcatccccatcgtccttacactaactctagtctccaatcttgatctctccacc
actctcatcttcactggtttctacaacatcgccaccggtctcctctttgacatccctatg
cccgtccagcccatgaaatccatcgccgctgtcgctgtctccgaatccccgcatctaact
ccttctcagattgccgccgctggtgcatccactgccgccacgctcctcctccttggcgcc
accggagctatgtctttcctctacaacatcatccctctcccagttgtacgcggcgtccag
ctttctcaaggtcttcagttcgccttcaccgccatcaaatacgtcaggtttaattacgat
actgccactctcaaaccctcttcttctcctcgtatttggcttggcctcgacggccttatc
ttggctctagctgctctgctcttcatcattttgtccaccggctctggcaacgacagagaa
gctgaagatggagatctcgccgagacttccagcaacgaaagccagtctcgccggaggaga
ctgcgtcttctgtcttcgattccatctgcgctgatcgtgttcgcactcgggttagtgctc
tgtttcatacgtgatccatccattttcaaagaccttaaattcggtccctcgaagttccac
attctgagaatcagttgggatgattggaaaatcgggtttctgagggcggcgattcctcag
attccactctctgtactgaactcagtgatcgcagtttgtaaattatccaatgacttgttt
gacaaggaactctctgcgactacagtctccatcagcgttggggtgatgaacttaataggg
tgctggtttggcgctatgcccgtctgtcacggtgctggtgggttagctggtcagtatcgg
tttggggcaaggagtggattatccgttatttttctcggaatcgggaaactgattgtgggt
ctggtgtttggaaactcctttgtaaggattctgagtcagtttccgattggaattttaggg
gttctgttgctattcgcgggaatcgaactggcaatggcttccaaagacatgaactccaaa
gaagattccttcatcatgctggtctgcgccgctgtgtcgatgactggctcgagtgccgcc
ttaggatttggttgtggagttgttctttacttgttactgaagctaagaacgttagactgt
tcttcagtaactctgttttcccggtcaagtgatgagtcgcaggtcgattccgaagccgct
cctcgtgatgtctaa

DBGET integrated database retrieval system