KEGG   Arabidopsis thaliana (thale cress): AT2G01770
Entry
AT2G01770         CDS       T00041                                 

Symbol
VIT1
Name
(RefSeq) vacuolar iron transporter 1
  KO
K22736  vacuolar iron transporter family protein
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
KEGG Orthology (KO) [BR:ath00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ath02000]
    AT2G01770 (VIT1)
Transporters [BR:ath02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   AT2G01770 (VIT1)
SSDB
Motif
Pfam: VIT1 AlaDh_PNT_C DUF4168 PsbI
Other DBs
NCBI-GeneID: 814708
NCBI-ProteinID: NP_178286
TAIR: AT2G01770
UniProt: Q9ZUA5 A0A178VRP6
Position
2:complement(334663..336462)
AA seq 250 aa
MSSEEDKITRISIEPEKQTLLDHHTEKHFTAGEIVRDIIIGVSDGLTVPFALAAGLSGAN
ASSSIVLTAGIAEVAAGAISMGLGGYLAAKSEEDHYAREMKREQEEIVAVPETEAAEVAE
ILAQYGIEPHEYSPVVNALRKNPQAWLDFMMRFELGLEKPDPKRALQSAFTIAIAYVLGG
FIPLLPYMLIPHAMDAVVASVVITLFALFIFGYAKGHFTGSKPLRSAFETAFIGAIASAA
AFCLAKVVQH
NT seq 753 nt   +upstreamnt  +downstreamnt
atgtcgtcggaggaagataagattacaagaatctctatcgaaccggagaagcaaacactt
ctcgatcatcacaccgagaaacacttcaccgccggagaaatcgtacgtgacatcatcatc
ggcgtctctgatggtttaaccgttccttttgccctcgccgccggtctctccggtgccaat
gcttcttcttctatagtccttaccgctggaatcgccgaagtcgcggccggtgctatctcc
atgggactcggcgggtatttagcggcaaagagcgaagaagatcattacgcgagggagatg
aaacgagaacaagaagagatcgtggccgttcctgaaactgaggcagctgaagtggcagag
attctggcacagtacgggatagagccacatgaatattcacctgtagttaatgctcttcgt
aagaatcctcaagcttggcttgattttatgatgaggtttgagctgggattagagaagcct
gatccaaaaagagcgttacaaagcgcgttcacgattgcaatcgcttatgttcttggcggt
tttataccgttacttccctacatgctcataccgcatgccatggatgcggtagtggcgtct
gtggttataactctgtttgcgctcttcatatttggctatgcaaaagggcatttcactgga
agcaagcccctcagaagtgcgtttgaaaccgcctttataggagcgattgcttcagctgct
gctttttgtttggctaaagttgtgcaacattag

DBGET integrated database retrieval system