KEGG   Arabidopsis thaliana (thale cress): AT2G01830
Entry
AT2G01830         CDS       T00041                                 

Gene name
WOL
Definition
(RefSeq) CHASE domain containing histidine kinase protein
  KO
K14489  arabidopsis histidine kinase 2/3/4 (cytokinin receptor) [EC:2.7.13.3]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04075  Plant hormone signal transduction
Brite
KEGG Orthology (KO) [BR:ath00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04075 Plant hormone signal transduction
    AT2G01830 (WOL)
Enzymes [BR:ath01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     AT2G01830 (WOL)
SSDB
Motif
Pfam: CHASE HATPase_c Response_reg HisKA
Other DBs
NCBI-GeneID: 814714
NCBI-ProteinID: NP_849925
MIPS: AT2G01830.1
TAIR: AT2G01830
UniProt: Q9C5U0
Structure
PDB: 

Position
2
AA seq 1080 aa
MRRDFVYNNNAMFNPLTTHYSSDMNWALNNHQEEEEEPRRIEISDSESLENLKSSDFYQL
GGGGALNSSEKPRKIDFWRSGLMGFAKMQQQQQLQHSVAVKMNNNNNNDLMGNKKGSTFI
QEHRALLPKALILWIIIVGFISSGIYQWMDDANKIRREEVLVSMCDQRARMLQDQFSVSV
NHVHALAILVSTFHYHKNPSAIDQETFAEYTARTAFERPLLSGVAYAEKVVNFEREMFER
QHNWVIKTMDRGEPSPVRDEYAPVIFSQDSVSYLESLDMMSGEEDRENILRARETGKAVL
TSPFRLLETHHLGVVLTFPVYKSSLPENPTVEERIAATAGYLGGAFDVESLVENLLGQLA
GNQAIVVHVYDITNASDPLVMYGNQDEEADRSLSHESKLDFGDPFRKHKMICRYHQKAPI
PLNVLTTVPLFFAIGFLVGYILYGAAMHIVKVEDDFHEMQELKVRAEAADVAKSQFLATV
SHEIRTPMNGILGMLAMLLDTELSSTQRDYAQTAQVCGKALIALINEVLDRAKIEAGKLE
LESVPFDIRSILDDVLSLFSEESRNKSIELAVFVSDKVPEIVKGDSGRFRQIIINLVGNS
VKFTEKGHIFVKVHLAEQSKDESEPKNALNGGVSEEMIVVSKQSSYNTLSGYEAADGRNS
WDSFKHLVSEEQSLSEFDISSNVRLMVSIEDTGIGIPLVAQGRVFMPFMQADSSTSRNYG
GTGIGLSISKCLVELMRGQINFISRPHIGSTFWFTAVLEKCDKCSAINHMKKPNVEHLPS
TFKGMKAIVVDAKPVRAAVTRYHMKRLGINVDVVTSLKTAVVAAAAFERNGSPLPTKPQL
DMILVEKDSWISTEDNDSEIRLLNSRTNGNVHHKSPKLALFATNITNSEFDRAKSAGFAD
TVIMKPLRASMIGACLQQVLELRKTRQQHPEGSSPATLKSLLTGKKILVVDDNIVNRRVA
AGALKKFGAEVVCAESGQVALGLLQIPHTFDACFMDIQMPQMDGFEATRQIRMMEKETKE
KTNLEWHLPILAMTADVIHATYEECLKSGMDGYVSKPFEEENLYKSVAKSFKPNPISPSS
NT seq 3243 nt   +upstreamnt  +downstreamnt
atgagaagagattttgtgtataataataatgcaatgttcaatcctctcacaactcattac
agctcagatatgaactgggcactcaacaatcatcaagaagaagaagaagagccacgaaga
attgaaatttctgattccgagtcactagaaaacttgaaaagcagcgatttttatcaactg
ggtggtggtggtgctctgaattcgtcagaaaagccgagaaagatcgatttttggcgttcg
gggttgatgggttttgcgaagatgcagcagcagcaacagcttcagcattcagtggcggtg
aagatgaacaataataataataacgatctaatgggtaataaaaaagggtcaactttcata
caagaacatcgagcattgttaccaaaagctttgattctgtggatcatcattgttgggttt
ataagcagtgggatttatcagtggatggatgatgctaataagattagaagggaagaggtt
ttggtcagcatgtgtgatcaaagagctagaatgttgcaggatcaatttagtgttagtgtt
aatcatgttcatgctttggctattctcgtctccacttttcattaccacaagaacccttct
gcaattgatcaggagacatttgcggagtacacggcaagaacagcatttgagagaccgttg
ctaagtggagtggcttatgctgaaaaagttgtgaattttgagagggagatgtttgagcgg
cagcacaattgggttataaagacaatggatagaggagagccttcaccggttagggatgag
tatgctcctgttatattctctcaagatagtgtctcttaccttgagtcactcgatatgatg
tcaggcgaggaggatcgtgagaatattttgcgagctagagaaaccggaaaagctgtcttg
actagcccttttaggttgttggaaactcaccatctcggagttgtgttgacattccctgtc
tacaagtcttctcttcctgaaaatccgactgtcgaagagcgtattgcagccactgcaggg
taccttggtggtgcgtttgatgtggagtctctagtcgagaatttacttggtcagcttgct
ggtaaccaagcaatagttgtgcatgtgtatgatatcaccaatgcatcagatccacttgtc
atgtatggtaatcaagatgaagaagccgacagatctctctctcatgagagcaagctcgat
tttggagaccccttcaggaaacataagatgatatgcaggtaccaccaaaaggcaccaata
ccgttgaatgtgctcacaactgtgccattgttctttgcgattggtttcttggtgggttat
atactgtatggtgcagctatgcacatagtaaaagtcgaagatgatttccatgaaatgcaa
gagcttaaagttcgagcagaagctgctgatgtcgctaaatcgcagtttcttgctaccgtg
tctcacgagatcaggacaccaatgaatggcattctcggaatgcttgctatgctcctagat
acagaactaagctcgacacagagagattacgctcaaaccgctcaagtatgtggtaaagct
ttgattgcattgataaatgaggttcttgatcgcgccaagattgaagctggaaagctggag
ttggaatcagtaccatttgatatccgttcaatattggatgatgtcctttctctattctct
gaggagtcaaggaacaaaagcattgagctcgcggttttcgtttcagacaaagtaccagag
atagtcaaaggagattcagggagatttagacagataatcataaaccttgttggaaattcg
gttaaattcacagagaaaggacatatctttgttaaagtccatcttgcggaacaatcaaaa
gatgaatctgaaccgaaaaatgcattgaatggtggagtgtctgaagaaatgatcgttgtt
tccaaacagtcaagttacaacacattgagcggttacgaagctgctgatggtcggaatagc
tgggattcattcaagcatttggtctctgaggagcagtcattatcggagtttgatatttct
agcaatgttaggcttatggtttcaatcgaagacacgggtattggaatccctttagttgcg
caaggccgtgtgtttatgccgtttatgcaagcagatagctcgacttcaagaaactatgga
ggtactggtattggtttgagtataagcaagtgtcttgttgaacttatgcgtggtcagata
aatttcataagccggcctcatattggaagcacgttctggttcacggctgttttagagaaa
tgcgataaatgcagtgcgattaaccatatgaagaaacctaatgtggaacacttgccttct
acttttaaaggaatgaaagctatagttgttgatgctaagcctgttagagctgctgtgact
agataccatatgaaaagactcggaatcaatgttgatgtcgtgacaagtctcaaaaccgct
gttgttgcagctgctgcgtttgaaagaaacggttctcctctcccaacaaaaccgcaactt
gatatgatcttagtagagaaagattcatggatttcaactgaagataatgactcagagatt
cgtttattgaattcaagaaccaacggaaacgttcatcacaagtctccgaaactagctcta
ttcgcaacaaacatcacaaattcggagttcgacagagctaaatccgcaggatttgcagat
acggtaataatgaaaccgttaagagcaagcatgattggggcgtgtctgcaacaagttctc
gagctgagaaaaacaagacaacaacatccagaaggatcatcacccgcaactctcaagagc
ttgcttacagggaagaagattcttgtggttgatgataatatagttaacaggagagtagct
gcaggagctctcaagaaatttggagcagaagtggtttgtgcagagagtggtcaagttgct
ttgggtttgcttcagattccacacactttcgatgcttgcttcatggatattcaaatgcca
cagatggacggatttgaagcaactcgtcagataagaatgatggagaaggaaactaaagag
aagacaaatctcgaatggcatttaccgattctagcgatgactgcggatgtgatacacgcg
acctacgaggaatgtctgaaaagtgggatggatggttacgtctccaaaccttttgaagaa
gagaatctctataaatccgttgccaaatcattcaaacctaatcctatctcaccttcgtcg
taa

DBGET integrated database retrieval system