KEGG   Arabidopsis thaliana (thale cress): AT2G02160Help
Entry
AT2G02160         CDS       T00041                                 

Definition
(RefSeq) CCCH-type zinc finger family protein
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: zf-CCCH_3 zf_CCCH_4 Torus zf-CCCH_2 zf-CCCH_4 zf-CCCH
Motif
Other DBs
NCBI-GeneID: 814747
NCBI-ProteinID: NP_027420
MIPS: AT2G02160.1
TAIR: AT2G02160
Araport: AT2G02160
UniProt: Q9ZUM0
Position
2
AA seq 669 aa AA seqDB search
MFAPATQPQQQHEQKKQSETVSSAEEDALKWNTDCVYFLASPLTCKKGPECEYRHSEYAR
MNPRDCYYWLNGNCLNPKCGFRHPPLEGLLGNQGGAPAVSVQPIHATAQHPSVAKQPVPC
LFFQKGMCMKGDMCSFLHTPNPAAYKKQHPVEAKPATDPQCSKKPIENNTEEKKLPDVNL
SKVVKGHTDISAAPRVASTGLRDSRSVEGYIPNHVGYEPVVQRKGPGFPSFTEGGHSTQL
LQKYGSDDNNSFHNGKDADDVLRESSPGFDVLVDNEAGDSEYYHVEDRYGRRSQERGNSE
YDPDFSAIADGDKEALREQRFDSYDRREDRGWGHRRVSSEREDRLDRRVYAEDERSENIL
ESDLRYRLAKQRKGNGMRLSVGGHDYAAPDSSMDRGYRESRRDTPRENSISSSRLQGRIK
LRERSNGEEGHHFDRRSERGRDRSELPSQGRLRDRIKGRLEENHSGNQERGFGAPWARRR
EMEDERKSAPKSSREESKPEPSLGKRKSFEEDHHSHKRSRDSFAAPLPFSEILKRKKAAA
SGGSRNNNKDETISKEEAGDEIKLITEEKTEVVSEPKAEVEEEGTVMEEEEIVGEEVYEG
NEDEQAYEGDELNGEYYYEEGYEEEGGEYAYEEGEEVVYAAEEGEEEATEGGEGEGEEDI
EKKTVEMLS
NT seq 2010 nt NT seq  +upstreamnt  +downstreamnt
atgtttgcgcctgcgactcaaccgcaacagcaacatgagcagaagaagcaatcagagact
gtttcatctgctgaagaagatgctttgaagtggaacaccgattgcgtttactttctcgct
tctcctttaacctgcaagaagggacctgaatgcgagtatcgccacagtgagtatgcgcgt
atgaacccgagggattgctattattggttgaatggaaactgtttgaatcccaaatgtgga
tttcggcatcctcctttggagggattgttgggaaatcaaggaggtgctcctgctgtttct
gtacagccaatacatgcaaccgcgcagcatcctagtgttgcaaaacagcctgttccatgt
ctgttctttcaaaaaggcatgtgtatgaaaggagatatgtgttcgttcttgcacacgccg
aatcctgctgcgtataaaaaacagcatcctgtagaagctaagcctgctactgatcctcag
tgttctaaaaagccaattgaaaataacactgaggagaagaaacttcctgatgttaatctc
tcaaaggtggttaaaggacatactgacatatcggctgcaccaagagtcgcttctactgga
ctaagggatagtagaagtgtagagggatacattccaaaccatgtgggatatgagcctgtt
gtgcagagaaagggtccaggattcccttcttttactgaaggaggccattctactcagttg
cttcagaaatatggatctgatgataataacagtttccacaatggtaaggatgcagatgac
gttttaagagagtcgtctcctgggtttgatgttcttgtggataatgaggctggagattct
gagtattatcatgttgaagatcgatatggacgtagaagtcaggagagagggaactcagag
tatgaccctgatttcagtgcaattgctgatggtgataaagaagcattacgtgaacaacgt
tttgattcatatgatcggagggaagacaggggatggggccatcgtcgagtttcttctgag
agagaggatcgtttggacagaagggtttacgcagaagatgagagatcagagaacatactg
gaatcggatctgagatatcgtttggctaagcagagaaaaggcaatggtatgagattatca
gtaggaggccatgactatgctgctcctgactcttcgatggacagaggatatagagagtct
cgtagggatacaccgagggaaaactccattagcagtagtcgtcttcagggtagaattaag
cttcgtgagagaagcaatggcgaagagggtcaccactttgacaggagaagtgagagggga
agggacagaagcgagttaccttctcagggtagactccgagatagaattaagggtaggtta
gaggaaaaccatagtggtaatcaggaaagaggtttcggggctccatgggcgagaagaaga
gaaatggaagacgaaagaaaatcagctcctaaaagcagcagagaggaaagtaagccagag
ccatctcttgggaagaggaaaagctttgaagaggatcatcatagtcataagcgatcaagg
gattcatttgcagctccattgcctttcagtgagattctcaagagaaaaaaagcggccgca
tctggtggtagcagaaacaacaacaaggacgagacgatatcgaaagaggaagctggagat
gagatcaaactcataaccgaagagaaaaccgaggttgtctctgaacccaaagctgaagta
gaagaagaaggaacggttatggaggaagaagaaattgttggggaggaagtgtatgaagga
aatgaagacgagcaagcttatgaaggcgatgagctaaacggagagtactattacgaagaa
ggatatgaagaagagggaggagaatacgcttacgaagaaggtgaagaagtagtttacgcg
gctgaggaaggagaagaagaagcaacagaaggaggtgaaggtgagggtgaagaagacatt
gagaagaagaccgttgagatgttgtcataa

DBGET integrated database retrieval system