KEGG   Arabidopsis thaliana (thale cress): AT2G02860
Entry
AT2G02860         CDS       T00041                                 
Symbol
SUT2
Name
(RefSeq) sucrose transporter 2
  KO
K15378  solute carrier family 45, member 1/2/4
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
KEGG Orthology (KO) [BR:ath00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ath02000]
    AT2G02860 (SUT2)
Transporters [BR:ath02000]
 Solute carrier family (SLC)
  SLC45: H+/sugar cotransporter
   AT2G02860 (SUT2)
SSDB
Motif
Pfam: MFS_1 MFS_2 Gate DUF1440 DUF3169
Other DBs
NCBI-GeneID: 814817
NCBI-ProteinID: NP_178389
TAIR: AT2G02860
UniProt: O80605 Q0WV10
Position
2:complement(828279..832619)
AA seq 594 aa
MSDSVSISVPYRNLRKEIELETVTKHRQNESGSSSFSESASPSNHSDSADGESVSKNCSL
VTLVLSCTVAAGVQFGWALQLSLLTPYIQTLGISHAFSSFIWLCGPITGLVVQPFVGIWS
DKCTSKYGRRRPFILVGSFMISIAVIIIGFSADIGYLLGDSKEHCSTFKGTRTRAAVVFI
IGFWLLDLANNTVQGPARALLADLSGPDQRNTANAVFCLWMAIGNILGFSAGASGKWQEW
FPFLTSRACCAACGNLKAAFLLAVVFLTICTLVTIYFAKEIPFTSNKPTRIQDSAPLLDD
LQSKGLEHSKLNNGTANGIKYERVERDTDEQFGNSENEHQDETYVDGPGSVLVNLLTSLR
HLPPAMHSVLIVMALTWLSWFPFFLFDTDWMGREVYHGDPTGDSLHMELYDQGVREGALG
LLLNSVVLGISSFLIEPMCQRMGARVVWALSNFTVFACMAGTAVISLMSLSDDKNGIEYI
MRGNETTRTAAVIVFALLGFPLAITYSVPFSVTAEVTADSGGGQGLAIGVLNLAIVIPQM
IVSLGAGPWDQLFGGGNLPAFVLASVAAFAAGVIALQRLPTLSSSFKSTGFHIG
NT seq 1785 nt   +upstreamnt  +downstreamnt
atgagtgactcggtgtcgatctcggttccgtataggaatttgaggaaggaaattgaactt
gagacggtcaccaagcatcgtcaaaacgaatctggttcttcgtcgttctctgaatctgct
tctccttcgaatcattctgattcggctgatggtgaatctgtgtcgaagaattgtagttta
gtgacgttggttcttagttgtacagttgccgctggagttcaatttggttgggcattgcaa
ctttctcttcttactccttatattcagacccttggaatatcgcatgctttttcttcgttt
atttggctgtgcggcccaattacaggccttgtggtccagccttttgttggcatttggagt
gataaatgtacttcaaagtatggaagaagacgaccatttattctagttggatcattcatg
atctcaatagcagtgataataatcggattttctgcagacattgggtatctgttaggagat
tcaaaggaacattgcagtactttcaaaggcacacgaaccagggcagctgttgtctttatc
attgggttttggttgttggatctagcaaacaatacagtacagggacctgctcgtgctctt
ctagctgatctatcaggtcctgatcagcggaatactgcaaatgctgtgttctgcttgtgg
atggctattgggaacatccttgggttttctgccggtgctagcggaaaatggcaagaatgg
ttcccttttttaactagtagagcatgttgtgctgcatgtggaaatctcaaagcagcgttt
cttcttgcagtggtctttctcactatatgtactcttgtcacaatctattttgctaaagag
attccttttacaagcaacaagcccacccgcatacaagattctgcacctttgttggatgat
ctccagtccaaaggccttgagcattcaaaattaaataatggtactgccaatggaatcaag
tatgagagagtggaacgtgatacggatgaacagtttggcaattcagagaatgagcatcaa
gatgagacctacgttgatggccctggatctgttttagtgaatttgctaactagtttaagg
catttgccaccggctatgcactcagttcttatcgtcatggctcttacatggttatcctgg
ttccccttctttctgttcgatacagattggatgggaagagaagtttaccatggggatcca
acaggagatagtttgcatatggaactctatgatcaaggtgtacgtgaaggtgcacttggt
ttgctactaaactctgttgttcttgggatcagctcatttctcattgaaccaatgtgtcag
cggatgggtgctcgggttgtatgggctttgagcaattttactgtatttgcctgcatggcg
ggaacagctgtaatcagcttgatgtctctcagtgatgacaaaaatggaattgaatacata
atgcgtggaaacgaaacaacaagaaccgcagccgtaatcgtttttgcactccttggtttt
cccctagctatcacatacagtgtccctttctctgtcacagcagaagtcactgctgattcc
ggtggcggtcaaggtttggctataggagtgttgaatctcgcaatcgttattccccagatg
atagtatcacttggagcgggtccatgggatcaattgtttggaggaggaaacttaccggcg
tttgttttggcgtctgttgctgctttcgctgctggagttattgcattgcaaaggcttccc
acgctatcgagttctttcaagtccaccggtttccacatcggctaa

DBGET integrated database retrieval system