KEGG   Arabidopsis thaliana (thale cress): AT2G04040
Entry
AT2G04040         CDS       T00041                                 
Symbol
DTX1
Name
(RefSeq) MATE efflux family protein
  KO
K03327  multidrug resistance protein, MATE family
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
KEGG Orthology (KO) [BR:ath00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ath02000]
    AT2G04040 (DTX1)
Transporters [BR:ath02000]
 Solute carrier family (SLC)
  SLC47: Multidrug and Toxin Extrusion (MATE) family
   AT2G04040 (DTX1)
SSDB
Motif
Pfam: MatE
Other DBs
NCBI-GeneID: 814938
NCBI-ProteinID: NP_178491
TAIR: AT2G04040
UniProt: Q9SIA5 A0A178VPK7
Position
2:complement(1334270..1336550)
AA seq 476 aa
MEEPFLLRDELLVPSQVTWHTNPLTVELKRVSRLAAPMATVTIAQYLLPVISVMVAGHNG
ELQLSGVALANSFTNVTGFSIMCGLVGALETLCGQAYGAKQYEKIGTYAYSAIASNIPIC
FLISILWLYIEKILISLGQDPEISRIAGSYAFWLIPALFGQAIVIPLSRFLLTQGLVIPL
LFTAVTTLLFHVLVCWTLVFLFGLGCNGPAMATSVSFWFYAVILSCYVRFSSSCEKTRGF
VSRDFVSSIKQFFQYGIPSAAMICLEWWLFEILILCSGLLPNPKLETSVLSICLTIETLH
YVISAGVAAAVSTRVSNNLGAGNPQVARVSVLAGLCLWIVESAFFSILLFTCRNIIGYAF
SNSKEVLDYVADLTPLLCLSFILDGFTAVLNGVARGSGWQHIGAWNNTVSYYLVGAPVGI
YLAFSRELNGKGLWCGVVVGSTVQATILAIVTASINWKEQAEKARKRIVSTENRLA
NT seq 1431 nt   +upstreamnt  +downstreamnt
atggaggagccatttcttctgagagacgagcttctagtcccttctcaagtcacatggcat
acaaatccattaaccgtcgagctaaagagagtgagccgcttggccgctcctatggccact
gtgaccattgctcagtacttattgcctgtcatctcggtcatggtcgctggccacaacggc
gagctccagctctccggtgtcgctcttgcaaactccttcacaaacgtcaccggttttagc
attatgtgtggattagtgggtgcacttgaaactctttgtggccaagcttatggagccaaa
caatatgaaaaaatcggaacttacgcatactctgctattgcttccaacataccaatttgt
ttcctcatatcaattctctggctttacatcgaaaagatcttgatttctctcggacaagac
cctgaaatttcaagaatcgctggctcctacgccttttggcttataccggctttatttggc
caagcgattgtcataccactgtcccggtttctgctaacacaagggttggttattcctctg
ctcttcactgccgtgaccacccttttgttccacgttttggtttgttggactttggttttc
ttgtttggtctgggatgtaatggacctgccatggctacaagtgtgtctttctggttttac
gctgtgatactctcatgttatgtgagattctccagctcttgcgagaagactcgcggattt
gtatcccgagattttgtgtcttctatcaagcagttcttccaatacggaatcccatcagct
gcaatgatttgtctagaatggtggctatttgagatactcatactctgctcaggtcttctc
cctaacccgaaactcgagacctctgttctttcaatttgtcttacaatagaaactttgcac
tatgtgatttcagctggagtcgccgcggctgtgagcacacgtgtatcaaacaatttggga
gctgggaatcctcaagttgctagggtttcagtattagcagggctttgtctctggatagta
gagtcagctttctttagcatacttctattcacctgcaggaacatcataggatacgcattc
agcaacagcaaagaagttttggactatgtagctgacctaactcctttgctctgcctctcc
tttatcctcgacggcttcacagcagttctaaatggagttgctaggggaagtggttggcaa
cacattggagcttggaacaatactgtttcttattatcttgtaggagctcctgttggaatt
tacttagctttcagtcgtgagttgaacggaaaaggactgtggtgcggtgttgtggttgga
tctactgtgcaagccactatactggctattgtcacagcttccataaattggaaggaacag
gctgagaaggcaaggaagagaattgtctcaactgaaaacagattggcttaa

DBGET integrated database retrieval system