KEGG   Arabidopsis thaliana (thale cress): AT2G06020
Entry
AT2G06020         CDS       T00041                                 

Definition
(RefSeq) Homeodomain-like superfamily protein
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB
Motif
Pfam: Myb_DNA-binding HMw1_D2 Ribosomal_S5_C
Other DBs
NCBI-GeneID: 815156
NCBI-ProteinID: NP_178659
MIPS: AT2G06020.1
TAIR: AT2G06020
UniProt: Q9ZPZ8
Position
2
AA seq 301 aa
MKKQEKGNEVVTFEENPSTYVHHHTKKASMVLSEQEIEVILQSNKETYNEKLEKNTKENA
EKVGIEEGNGSSSKITPCIFYTSDEKARLRWSSDLHDCFVNAVEKLGGPNKATPKSVKEA
MEVEGIALHHVKSHLQKFRLGKCNIRGGTNQYVRQSQSMPHKSQQQLQLNNDCVNHDSYC
NATFLSVTVPPTIDSLHQDTLNNTILFPTTLQAIPTSVSHNTYMSSYPSYNTVEVVKAQL
NALQDSSTSQTQETFSRETNLSSIVTRDEADPVDKYIDWNKVGETDIEHDSVEVLEALGL
K
NT seq 906 nt   +upstreamnt  +downstreamnt
atgaagaagcaagaaaaaggaaacgaagttgtcactttcgaagaaaatcctagcacttat
gttcatcatcacacgaaaaaagcctcaatggttttaagtgagcaagaaatagaggttatt
ctacaaagtaataaggagacatataatgaaaaattagaaaaaaatacgaaagagaatgct
gagaaagttggtattgaagaaggaaatggttcatcttcaaagatcacgccatgcattttc
tacacatctgatgaaaaggcacgattgaggtggtcaagcgaccttcacgattgctttgtt
aatgctgtggaaaaacttggtggacctaacaaagcgacgccaaaaagtgttaaagaggca
atggaagttgaaggaattgcacttcaccatgtgaagagtcatcttcagaaatttagactt
ggaaagtgtaacatacggggtggaacaaatcaatatgttagacagtcacaatccatgcct
cacaagagtcaacaacaacttcagctcaacaatgattgtgtcaatcatgactcatattgc
aatgcaacttttttatcggtcacggtaccaccaacaattgattctcttcatcaggacact
ttaaacaatacaattctttttccaacgacactacaagcaataccgacatctgtgtcacac
aatacgtacatgagttcatatccttcatacaatactgttgaagttgttaaagctcagctc
aatgcattacaagattcaagcactagccaaacacaagaaacattttctcgtgaaaccaac
ttatcgtctatagtcacaagggatgaagcagatccagtggataagtatattgattggaac
aaagttggagaaactgatattgaacatgattcagtcgaagtccttgaggctttaggtttg
aagtaa

DBGET integrated database retrieval system