KEGG   Arabidopsis thaliana (thale cress): AT2G13640
Entry
AT2G13640         CDS       T00041                                 
Name
(RefSeq) Transcription factor IIS family protein
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB
Motif
Pfam: Med26 YwpF HsdM_N
Other DBs
NCBI-GeneID: 815849
NCBI-ProteinID: NP_178987
TAIR: AT2G13640
UniProt: Q9SIT3
Position
2:complement(5686136..5687290)
AA seq 384 aa
MIKNDGKMMRVRIAKERSDLCDLTAAAIKATYNTRNPCEVERCIDVLNHLKSLSLSVKDI
RLSESIVKLETLRSHRNPRIRKEAQALFHSWLKTFYAHGSDNSFTAALTKDRLKMKKHVL
KMCSELKKKEEPGTMARQVTAFSVLKNKEDERSQTTVEAVESKTTIKLSELNRKEDQRSL
TRETEKNKARNSFLALKQKEDHRSETCVEKYFKKETKTNLKQLNMKTRRVSLEDVTTKKP
HEDGSLIKKTKTEKELKKKKVDEMVKLFEAAKKAADVANAKGVLSGKPEVSRCIDALSLL
MKINITPKPKEPRRMMDKLEGLTKHKDRKICHVASALLHLWRQRIREQERKKSVTKASSK
TRKLSYVKIIWLEQIKVSCGFKRF
NT seq 1155 nt   +upstreamnt  +downstreamnt
atgatcaagaacgacggaaagatgatgagagtgagaattgcgaaggagagatctgactta
tgcgacttgactgctgctgcaattaaggctacttacaatacacggaacccatgcgaagtc
gagcgatgcatcgatgtgttgaatcacttgaagtctctgtctctttccgtgaaggatata
cgattgtctgaatcaatagttaaactggagactttgagaagtcataggaaccctagaatc
cgtaaggaagcccaagccttgtttcattcatggttgaagacattctacgcacatggaagc
gacaactctttcacagctgctcttaccaaagatcgtctgaagatgaagaagcatgttcta
aaaatgtgttcggagttgaagaagaaagaagaaccgggaactatggctcgtcaagtcact
gccttttcggtgttgaagaataaagaagacgagagatctcagacgactgttgaagcagta
gagagtaagacaacgatcaaactctcggagttgaataggaaagaagatcagagatcatta
actcgtgaaacagagaagaataaagcaaggaacagctttttggctttgaaacagaaagag
gatcatagatctgagacttgtgtcgagaaatattttaagaaagagacaaagaccaatcta
aagcagctcaacatgaagacaaggcgtgtctctttggaggatgttacaacgaagaagcca
catgaagatggttcattgataaagaagactaaaacagaaaaggagctgaagaagaagaaa
gtggatgagatggtgaagttgttcgaagcagcaaagaaagctgctgatgtggccaacgct
aagggtgttctctcaggtaaaccagaggtgtctcgctgcattgacgctctctcgttattg
atgaagatcaacattactccaaaaccaaaagaaccaaggaggatgatggataagcttgag
ggacttacaaaacataaagatcgcaagatttgccatgttgcatcagcccttcttcacctt
tggagacagaggatcagagaacaagaacgtaaaaagtctgttaccaaggcttcatcaaag
acgaggaaacttagttatgtgaagatcatatggcttgaacaaatcaaagtctcttgtgga
ttcaaaaggttctga

DBGET integrated database retrieval system