KEGG   Arabidopsis thaliana (thale cress): AT2G13680Help
Entry
AT2G13680         CDS       T00041                                 

Gene name
CALS5
Definition
(RefSeq) callose synthase 5
  KO
K11000  callose synthase [EC:2.4.1.-]
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
KEGG Orthology (KO) [BR:ath00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:ath01003]
    AT2G13680 (CALS5)
Enzymes [BR:ath01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.-  
     AT2G13680 (CALS5)
Glycosyltransferases [BR:ath01003]
 Polysaccharide
  Structural polysaccharide
   AT2G13680 (CALS5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glucan_synthase FKS1_dom1 Vta1
Motif
Other DBs
NCBI-GeneID: 815852
NCBI-ProteinID: NP_849953
MIPS: AT2G13680.1
TAIR: AT2G13680
Araport: AT2G13680
UniProt: Q3B724
Position
2
AA seq 1923 aa AA seqDB search
MAQSSTSHDSGPQGLMRRPSRSAATTVSIEVFDHEVVPASLGTIAPILRVAAEIEHERPR
VAYLCRFYAFEKAHRLDPSSGGRGVRQFKTLLFQRLERDNASSLASRVKKTDGREVESFY
QQYYEHYVRALDQGDQADRAQLGKAYQTAGVLFEVLMAVNKSEKVEAVAPEIIAAARDVQ
EKNEIYAPYNILPLDSAGASQSVMQLEEVKAAVAALGNTRGLNWPSGFEQHRKKTGNLDL
LDWLRAMFGFQRDNVRNQREHLVCLFADNHIRLTPKPEPLNKLDDRAVDTVMSKLFKNYK
NWCKFLGRKHSLRLPQAAQDIQQRKILYMGLYLLIWGEAANIRFMPECLCYIFHNMAYEL
HGLLAGNVSIVTGENIKPSYGGDDEAFLRKVITPIYRVVQTEANKNANGKAAHSDWSNYD
DLNEYFWTPDCFSLGWPMRDDGDLFKSTRDTTQGKKGSFRKAGRTGKSNFTETRTFWHIY
HSFDRLWTFYLLALQAMIILAFERVELREILRKDVLYALSSIFITAAFLRFLQSVLDVIL
NFPGFHRWKFTDVLRNILKIVVSLAWCVVLPLCYAQSVSFAPGKLKQWLSFLPQVKGVPP
LYIMAVALYLLPNVLAAIMFIFPMLRRWIENSDWHIFRLLLWWSQPRIYVGRGMHESQIA
LIKYTIFWLLLFCCKFAFSYFLQVKLLVKPTNAIMSIRHVKYKWHEFFPNAEHNYGAVVS
LWLPVILVYFMDTQIWYAIFSTICGGVIGAFDRLGEIRTLGMLRSRFQSLPGAFNTYLVP
SDKTRRRGFSLSKRFAEVTAARRTEAAKFSQLWNEIISSFREEDLISDREMDLLLVPYTS
DPSLKLIQWPPFLLASKIPIALDMAAQFRTRDSDLWKRICADEYMKCAVIECYESFKHVL
HTLVIGENEKRIIGIIIKEVESNISKNSFLSNFRMAPLPALCSKFVELVGILKNADPAKR
DTVVLLLQDMLEVVTRDMMQNENRELVELGHTNKESGRQLFAGTDAKPAILFPPVATAQW
HEQISRLHLLLTVKESAMDVPTNLEAQRRIAFFTNSLFMDMPRAPRVRNMLSFSVLTPYY
SEETVYSKNDLEMENEDGVSVVYYLQKIFPDEWTNFLERLDCKDETSVLESEENILQLRH
WVSLRGQTLFRTVRGMMYYRRALKLQAFLDMANETEILAGYKAISEPTEEDKKSQRSLYT
QLEAVADLKFTYVATCQNYGNQKRSGDRRATDILNLMVNNPSLRVAYIDEVEEREGGKVQ
KVFYSVLIKAVDNLDQEIYRIKLPGPAKIGEGKPENQNHALIFTRGEALQAIDMNQDHYL
EEALKMRNLLEEFNEDHGVRAPTILGFREHIFTGSVSSLAWFMSNQETSFVTIGQRVLAS
PLKVRFHYGHPDVFDRIFHITRGGISKASRGINLSEDIFAGFNSTLRRGNVTHHEYIQVG
KGRDVGLNQISLFEAKVACGNGEQTLSRDLYRLGHRFDFFRMMSCYFTTVGFYISSMIVV
LTVYAFLYGRLYLSLSGVEEAIVKFAAAKGDSSLKAAMASQSVVQLGLLMTLPMVMEIGL
ERGFRTALSDLIIMQLQLAPVFFTFSLGTKVHYYGRTILHGGSKYRATGRGFVVKHEKFA
ENYRMYSRSHFVKGMELMVLLICYRIYGKAAEDSVGYALVMGSTWFLVGSWLFAPFFFNP
SGFEWQKIVDDWDDWNKWISSRGGIGVPANKSWESWWEEEQEHLLHSGFFGKFWEIFLSL
RYFIYQYGIVYQLNLTKESRMGKQHSIIVYGLSWLVIVAVMIVLKIVSMGRKKFSADFQL
MFRLLKLFLFIGSVVIVGMLFHFLKLTVGDIMQSLLAFLPTGWALLQISQVARPLMKTVG
MWGSVKALARGYEYIMGVVIFMPVTVLAWFPFVSEFQTRLLFNQAFSRGLQIQRILAGGK
KQK
NT seq 5772 nt NT seq  +upstreamnt  +downstreamnt
atggcacagagtagtacatctcatgactcaggccctcaggggctcatgagacggccatct
cgtagtgctgccacaacagtgtctattgaagtttttgatcatgaggtggttccggcctcc
cttggtaccattgctcctattctgcgtgttgctgcagagattgaacatgagcgccctcgt
gttgcctatctctgtcggttttatgcatttgagaaagctcacaggttggatccaagctct
ggtggtcgaggtgtgaggcagtttaagacacttctctttcaaagattagaaagggacaat
gcttccagtcttgcttctagggtgaaaaaaactgatggacgggaagttgagagcttctat
caacaatattatgagcactatgtcagggcacttgatcaaggagatcaagcagacagagct
cagcttggtaaagcataccagacggctggagtgctctttgaagtgctcatggcagttaac
aagagcgagaaagttgaagcagtagctcctgagattattgcagctgctagagatgtccaa
gaaaagaacgaaatttatgcaccctacaacattcttcctttggattctgctggggcctcg
cagtctgttatgcagcttgaggaggtcaaagccgctgtagctgctttggggaacactcgt
ggattgaactggccatctgggtttgagcagcaccgaaagaaaaccggaaatctggatctt
cttgactggttaagagctatgttcggattccagagagacaatgtcagaaaccagagggaa
catctggtttgtttatttgctgataatcacataagattgactcccaagccagaacctctg
aacaagctcgatgacagagccgttgatactgtcatgtcaaagctctttaagaactacaag
aattggtgcaaatttttaggacgtaaacacagtttaaggcttcctcaagctgctcaagat
atacaacagcggaagatactatatatgggcttgtatcttctcatctggggagaagctgca
aatattcgcttcatgccagaatgcttgtgctatattttccacaatatggcttatgaactc
catggtctcttggctggaaatgtcagcatcgttaccggagaaaatattaagccttcttac
ggtggagatgatgaggcatttttaaggaaggtcattacaccaatctaccgtgtagttcaa
acggaagcaaacaagaatgcaaatggcaaggctgctcactcagattggtccaactatgat
gatctgaacgaatatttctggactcctgattgcttctctcttggctggccaatgcgtgat
gatggggatcttttcaaatcaacccgtgatacgacacagggaaagaaaggatcgtttaga
aaagcaggacgcacaggcaaatcaaatttcaccgaaactcggacattttggcacatatat
catagttttgaccgactctggacattctatctattagccctgcaggcaatgatcattcta
gcatttgaacgagtagagctgagagaaatcttacgcaaagatgttttatatgctctctca
agtatcttcatcacagcagcttttctgcgcttccttcagagtgtcctggacgttatctta
aacttcccaggtttccacaggtggaaatttactgatgttttgagaaatattctcaagatc
gttgtcagtctcgcttggtgtgttgtgttacccctttgctatgcccagtctgtctctttt
gctcctgggaagctgaaacaatggctatcatttcttccacaagttaaaggcgttcctcct
ctttatatcatggctgttgcactgtacttgcttccaaatgtactggcagctatcatgttc
atttttccaatgcttcgacgctggatcgagaattcagactggcatatatttagattgctt
ctgtggtggtcacagccaagaatttatgttggaagagggatgcatgaaagtcaaattgca
ctcataaagtatacgattttctggctgttgcttttctgctgcaaatttgcattcagctac
tttctacaggtgaaacttttggtgaagccaactaacgcaattatgagcattcgccatgta
aaatacaaatggcatgagtttttccccaatgctgagcacaactatggagctgtggtgtca
ctctggttaccagtaattctggtttactttatggacactcaaatttggtatgctattttc
tccactatatgtggtggtgtcattggggcctttgatcgtttgggagagatacgaacgctt
ggaatgctaaggtcaaggttccaatcattacctggtgcatttaatacgtacctggttcct
tctgataaaacaaggagaagagggttttccttgtcaaaaagatttgcagaggtcactgca
gcaagaagaactgaagcggcaaaattctcccaactctggaatgaaatcatttccagcttc
cgagaggaagatctaatcagtgacagggagatggatctgttgcttgttccttatacttca
gaccctagtttgaaactaattcagtggccaccatttttgcttgcaagcaagataccgata
gcattggatatggcagctcagtttcgaacaagagattctgacctctggaagcgcatatgc
gcagacgaatatatgaaatgtgctgtcattgaatgctacgaatctttcaaacatgtcttg
cacaccttggtaattggggagaatgagaaaaggattattggtattatcatcaaagaggtg
gagagcaacatatcaaagaattccttcctttcgaatttcagaatggcgcctttacctgct
ctttgtagtaaatttgtcgagcttgttggaattttgaaaaatgcggacccagcgaaaaga
gacacagtggtgctattgttgcaagatatgttagaagtagtgactcgagatatgatgcaa
aatgaaaaccgtgaattggtagaacttgggcatactaacaaggaatccggaaggcaactc
tttgctggtactgacgcaaagcctgctatactgtttcctccagtggcaacagctcaatgg
catgaacagataagtcgccttcatttacttttgacggtaaaagaatctgcaatggatgtt
ccaacaaaccttgaagcacaaagaaggattgccttcttcacaaattcactgtttatggat
atgccacgagctcctcgtgtcagaaatatgctgtccttcagtgttctgactccgtactat
agtgaggaaaccgtctactctaagaacgacctggaaatggagaatgaagatggtgtatca
gttgtatactatttgcagaagatctttccagatgagtggactaacttcttggagcggctt
gattgtaaagatgaaacttctgttttggagagtgaagaaaatatattgcagcttcgccat
tgggtttctttgaggggacagactttgtttagaacagttagaggaatgatgtattacagg
cgggcattaaagcttcaggcttttcttgacatggctaatgaaacagaaatattagcaggg
tacaaagccatttcagagccaactgaggaggacaagaaaagtcagagatccttgtacact
cagttagaggcagtggcagatctcaaatttacttatgttgctacctgtcagaattatgga
aatcagaagcgaagtggagaccggagagctactgacatcttgaacctgatggttaacaat
ccctctctccgtgtagcatacattgatgaggttgaggaacgagaaggcggaaaagtgcag
aaagttttctactcggtgcttatcaaggctgttgataatcttgatcaggaaatatatcgg
ataaaactacctggaccagcaaaaattggagaaggaaaacccgaaaatcagaatcatgct
ctcatttttactagaggagaagctctccaggctattgacatgaatcaggaccattacttg
gaagaagcacttaaaatgaggaatctgctggaagagttcaatgaagaccatggagtacgt
gcacccactattcttggtttcagagagcatatttttactggcagtgtttcttctttagcc
tggtttatgtcaaatcaggaaacaagttttgtgaccattggtcagcgagtcctggcaagt
cctttgaaggtaaggtttcactatggacaccctgatgtcttcgatagaatcttccacatc
actcggggtggcatcagcaaagcttcacggggcataaatcttagcgaggatatctttgct
ggtttcaactcaactctgaggcgtggtaatgtcacccatcatgagtacatccaagtaggg
aaaggaagagatgttggtttgaaccagatatcactctttgaagccaaggttgcttgtgga
aacggagagcaaacattgagtagggatctctaccgacttgggcatcgttttgactttttc
cgcatgatgtcttgttatttcacaactgtaggcttctacatcagctcgatgattgttgtc
ctcacagtttatgcattcttgtatggaagactttacttgtcattgagtggagtggaagag
gcgatagtaaagtttgcagcagcgaaaggagatagttctcttaaggcagcgatggcgtca
cagtccgtagtgcaattgggtctgctgatgacactaccaatggtgatggagattgggcta
gagagaggattcagaacggcgttgtctgatctaatcataatgcagcttcagttagcgcct
gtcttcttcaccttctcacttggaacaaaggttcattactatggtcggaccatcctacat
gggggatcaaagtacagagcaacagggcgtgggtttgtggtgaagcacgagaagtttgca
gagaactacagaatgtattcgagaagccactttgtgaaaggaatggagctgatggtgctg
ctgatatgttacaggatttatgggaaagcagcagaggactcggtgggttatgcgcttgtc
atgggctcaacatggttcctggtgggttcctggttgttcgccccattctttttcaatccc
tcgggattcgagtggcagaagatagttgatgactgggatgattggaacaagtggataagc
agcagaggaggtatcggagtaccagcaaacaaaagctgggaatcatggtgggaagaggaa
caagagcatcttcttcactctgggtttttcggaaagttctgggagatatttctctcactg
cggtacttcatttaccagtatggtattgtgtaccaattgaacttgaccaaggagagccga
atgggaaaacagcacagcatcattgtgtatggactgtcttggctggtgatcgtggcagtg
atgatagtcctcaagatagtgtcgatggggagaaagaagttcagtgctgatttccagctt
atgttcaggcttttgaagctgtttctgttcataggatcagtggtgatcgtggggatgcta
ttccacttcttgaagctgaccgtgggagacataatgcagtctctgttggcgtttttaccc
acgggatgggctctccttcagatatcacaagtggcgaggccattgatgaagacagtagga
atgtggggatcggtcaaggccttggctagagggtatgagtacatcatgggagttgttatc
ttcatgccagttactgtactcgcgtggttccctttcgtctctgagttccagacaaggctt
ctcttcaatcaagcctttagccgtggtctccagatccaacgtattctcgccggtggtaag
aagcagaaataa

DBGET integrated database retrieval system