KEGG   Arabidopsis thaliana (thale cress): AT2G13790
Entry
AT2G13790         CDS       T00041                                 

Symbol
SERK4
Name
(RefSeq) somatic embryogenesis receptor-like kinase 4
  KO
K13417  somatic embryogenesis receptor kinase 4 [EC:2.7.10.1 2.7.11.1]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04626  Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:ath00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04626 Plant-pathogen interaction
    AT2G13790 (SERK4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:ath01001]
    AT2G13790 (SERK4)
Enzymes [BR:ath01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     AT2G13790 (SERK4)
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     AT2G13790 (SERK4)
Protein kinases [BR:ath01001]
 Serine/threonine kinases: TKL group
  IRAK family
   AT2G13790 (SERK4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr LRR_4 LRRNT_2 LRR_8 Pkinase_fungal APH Kinase-like ABC1
Other DBs
NCBI-GeneID: 815862
NCBI-ProteinID: NP_178999
TAIR: AT2G13790
UniProt: Q9SKG5
Position
2:5741592..5746833
AA seq 620 aa
MTSSKMEQRSLLCFLYLLLLFNFTLRVAGNAEGDALTQLKNSLSSGDPANNVLQSWDATL
VTPCTWFHVTCNPENKVTRVDLGNAKLSGKLVPELGQLLNLQYLELYSNNITGEIPEELG
DLVELVSLDLYANSISGPIPSSLGKLGKLRFLRLNNNSLSGEIPMTLTSVQLQVLDISNN
RLSGDIPVNGSFSLFTPISFANNSLTDLPEPPPTSTSPTPPPPSGGQMTAAIAGGVAAGA
ALLFAVPAIAFAWWLRRKPQDHFFDVPAEEDPEVHLGQLKRFTLRELLVATDNFSNKNVL
GRGGFGKVYKGRLADGNLVAVKRLKEERTKGGELQFQTEVEMISMAVHRNLLRLRGFCMT
PTERLLVYPYMANGSVASCLRERPEGNPALDWPKRKHIALGSARGLAYLHDHCDQKIIHR
DVKAANILLDEEFEAVVGDFGLAKLMNYNDSHVTTAVRGTIGHIAPEYLSTGKSSEKTDV
FGYGVMLLELITGQKAFDLARLANDDDIMLLDWVKEVLKEKKLESLVDAELEGKYVETEV
EQLIQMALLCTQSSAMERPKMSEVVRMLEGDGLAERWEEWQKEEMPIHDFNYQAYPHAGT
DWLIPYSNSLIENDYPSGPR
NT seq 1863 nt   +upstreamnt  +downstreamnt
atgacaagttcaaaaatggaacaaagatcactcctttgcttcctttatctgctcctacta
ttcaatttcactctcagagtcgctggaaacgctgaaggtgatgctttgactcagctgaaa
aacagtttgtcatcaggtgaccctgcaaacaatgtactccaaagctgggatgctactctt
gttactccatgtacttggtttcatgttacttgcaatcctgagaataaagttactcgtgtt
gaccttgggaatgcaaaactatctggaaagttggttccagaacttggtcagcttttaaac
ttgcagtacttggagctttatagcaataacattacaggggagatacctgaggagcttggc
gacttggtggaactagtaagcttggatctttacgcaaacagcataagcggtcccatccct
tcgtctcttggcaaactaggaaaactccggttcttgcgtcttaacaacaatagcttatca
ggggaaattccaatgactttgacttctgtgcagctgcaagttctggatatctcaaacaat
cggctcagtggagatattcctgttaatggttctttttcgctcttcactcctatcagtttt
gcgaataatagcttaacggatcttcccgaacctccgcctacttctacctctcctacgcca
ccaccaccttcaggggggcaaatgactgcagcaatagcagggggagttgctgcaggtgca
gcacttctatttgctgttccagccattgcgtttgcttggtggctcagaagaaaaccacag
gaccacttttttgatgtacctgctgaagaagacccagaggttcatttaggacaactcaaa
aggtttaccttgcgtgaactgttagttgctactgataactttagcaataaaaatgtattg
ggtagaggtggttttggtaaagtgtataaaggacgtttagccgatggcaatctagtggct
gtcaaaaggctaaaagaagaacgtaccaagggtggggaactgcagtttcaaaccgaagtt
gagatgatcagtatggccgttcataggaacttgcttcggcttcgtggcttttgcatgact
ccaactgaaagattacttgtttatccctacatggctaatggaagtgttgcttcttgttta
agagagcgtcctgaaggcaatccagcacttgattggccaaaaagaaagcatattgctctg
ggatcagcaagggggcttgcgtatttacatgatcattgcgaccaaaaaatcattcaccgg
gatgttaaagctgctaatatattgttagatgaagagtttgaagctgttgttggagatttt
gggctcgcaaaattaatgaattataatgactcccatgtgacaactgctgtacgcggtaca
attggccatatagcgcccgagtacctctcgacaggaaaatcttctgagaagactgatgtt
tttgggtacggggtcatgcttctcgagctcatcactggacaaaaggctttcgatcttgct
cggcttgcaaatgatgatgatatcatgttactcgactgggtgaaagaggttttgaaagag
aagaagttggaaagccttgtggatgcagaactcgaaggaaagtacgtggaaacagaagtg
gagcagctgatacaaatggctctgctctgcactcaaagttctgcaatggaacgtccaaag
atgtcagaagtagtgagaatgctggaaggagatggtttagctgagagatgggaagaatgg
caaaaggaggagatgccaatacatgattttaactatcaagcctatcctcatgctggcact
gactggctcatcccctattccaattcccttatcgaaaacgattacccctcgggtccaaga
taa

DBGET integrated database retrieval system