KEGG   Arabidopsis thaliana (thale cress): AT2G14620Help
Entry
AT2G14620         CDS       T00041                                 

Gene name
XTH10
Definition
(RefSeq) xyloglucan endotransglucosylase/hydrolase 10
  KO
K08235  xyloglucan:xyloglucosyl transferase [EC:2.4.1.207]
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
KEGG Orthology (KO) [BR:ath00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AT2G14620 (XTH10)
Enzymes [BR:ath01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.207  xyloglucan:xyloglucosyl transferase
     AT2G14620 (XTH10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_16 XET_C
Motif
Other DBs
NCBI-GeneID: 815950
NCBI-ProteinID: NP_179069
MIPS: AT2G14620.1
TAIR: AT2G14620
Araport: AT2G14620
UniProt: Q9ZVK1
Position
2
AA seq 299 aa AA seqDB search
MTLINRSKPFVLLVGFSIISSLLLWVSQASVVSSGDFNKDFFVTWSPTHVNTSNDGRSRT
LKLDQESGASFSSIQTFLFGQIDMKIKLIRGSSQGTVVAYYMSSDQPNRDEIDFEFLGNV
NGQPYILQTNVYAEGLDNREERIHLWFDPAKDFHTYSILWNIHQIVFMVDQIPIRLYRNH
GEKGVAYPRLQPMSVQASLWNGESWATRGGHDKIDWSKGPFVASFGDYKIDACIWIGNTS
FCNGESTENWWNKNEFSSLTRVQKRWFKWVRKYHLIYDYCQDYGRFNNKLPKECSLPKY
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgactctaataaatcgctcaaaaccatttgtacttctcgtaggcttctcaattatctca
agtttgctattatgggtctcacaagcttccgttgtttcatcaggagattttaacaaagac
ttctttgtgacatggtctcctacccacgttaacacctccaatgatggtcgatcaagaacc
cttaaactcgatcaagaatctggagcttctttttcttccattcagacgttcttgttcggc
caaatagatatgaagatcaaacttatccgtggaagttctcaaggaaccgtggttgcttat
tatatgtcctcagatcagcctaaccgggatgagattgactttgagttcctcggaaacgtt
aatgggcagccttacattctccagacaaatgtctatgccgagggacttgataaccgcgaa
gaaaggatccatctctggttcgacccagccaaggactttcacacttactctatcttgtgg
aacattcaccaaattgtatttatggtggatcagattccgataaggttgtatagaaaccat
ggggagaaaggcgtagcctacccaaggttgcaacctatgagtgtacaggcgagtctatgg
aacggtgagagctgggctacgcgcggtggacatgacaagattgattggtcaaagggtcca
tttgtggcttcctttggggattacaagatagacgcttgtatttggataggcaatacaagt
ttttgtaatggagagagcactgaaaactggtggaacaagaatgagttcagttctttgaca
agagtgcaaaagagatggtttaaatgggtgagaaaatatcacttgatttatgattattgc
caagattatggaaggttcaataacaagctaccgaaggaatgttctcttcctaaatattga

DBGET integrated database retrieval system