KEGG   Arabidopsis thaliana (thale cress): AT2G15880
Entry
AT2G15880         CDS       T00041                                 
Name
(RefSeq) Leucine-rich repeat (LRR) family protein
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB
Motif
Pfam: LRR_8 LRR_4
Other DBs
NCBI-GeneID: 816084
NCBI-ProteinID: NP_179188
TAIR: AT2G15880
UniProt: Q9XIL9
Position
2:complement(6917514..6920319)
AA seq 727 aa
MPHIYKQPLGIFQGFVPTLTDAEVSFIAQRQLLTLPENGELPDDIEYEVDLKVTFANHRL
KRAYIALQAWKKAVYSDPFNTTGNWHGPHVCGYTGVFCAPALDDPDVAVVAGVDLNGADI
AGHLPAELGLMTDVAMFHLNSNRFCGIIPKSFEKLSLMHEFDVSNNRFVGPFPSVVLSWP
AVKFIDVRYNDFEGQVPPELFKKDLDAIFLNNNRFTSTIPDSLGESSASVVTFAHNKFSG
CIPRSIGNMKNLNEIIFKDNSLGGCFPSEIGKLANVNVFDASMNSFTGVLPPSFVGLTSM
EEFDISGNKLTGFIPENICKLPKLVNLTYAYNYFNGQGDSCVPGSQKQIALDDTRNCLPD
RPKQRSAKECAVVISRPVDCSKDKCAGGSSQATPSKSPSPVPTRPVHKPQPPKESPQPND
PYNQSPVKFRRSPPPPQQPHHHVVHSPPPASSPPTSPPVHSTPSPVHKPQPPKESPQPND
PYDQSPVKFRRSPPPPPVHSPPPPSPIHSPPPPPVYSPPPPPPVYSPPPPPPVYSPPPPP
PVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVHSPPPPVYSPPPPPVHSPPPPVH
SPPPPVHSPPPPVYSPPPPPPVHSPPPPVFSPPPPVHSPPPPVYSPPPPVYSPPPPPVKS
PPPPPVYSPPLLPPKMSSPPTQTPVNSPPPRTPSQTVEAPPPSEEFIIPPFIGHQYASPP
PPMFQGY
NT seq 2184 nt   +upstreamnt  +downstreamnt
atgccccatatctataagcagcccttgggtattttccaaggttttgttccaacactcacc
gatgcagaagtttcatttattgcacagcgacagctcttgacgttacctgaaaatggtgaa
cttcctgatgatattgagtatgaggttgatcttaaggtgacatttgcaaaccataggctt
aagagagcgtatattgctctccaagcctggaaaaaggcggtgtattcagacccgtttaac
accacaggaaactggcatggccctcatgtgtgtggctatacgggtgtgttctgtgccccg
gctcttgatgatcctgacgtcgcggttgtggcgggggttgatttgaatggtgcggatatc
gcagggcatttaccggctgaacttggtttgatgacagatgttgcgatgtttcatttgaat
tcaaaccggttctgtggtatcatacctaagagtttcgagaagttgagcctaatgcacgag
tttgatgtcagcaacaaccggtttgtcggacctttcccttctgttgtcctctcgtggccg
gctgttaagttcattgacgtcagatacaatgatttcgaaggtcaagtccctcctgagctt
ttcaaaaaggatctcgacgccattttcctgaacaacaacagattcacgtctaccattcct
gattccctcggagaatcatcagcctccgttgtgacctttgctcacaacaaatttagcggt
tgtatccctagaagtattggaaacatgaagaatctcaacgagattatctttaaggacaac
agtcttggcggttgtttcccgtcagagattgggaagctagccaatgtgaacgtgtttgac
gctagcatgaactccttcactggtgttctacctccaagctttgtcgggcttaccagtatg
gaagagtttgatatctctgggaataaactcaccgggttcataccagagaatatatgcaag
ttgcctaaattggttaacttgacgtacgcctacaattacttcaacggacaaggtgattca
tgtgttccaggtagtcagaagcagattgcattggatgatacacgcaactgcttgccagat
cggcctaagcaacgatcggccaaggaatgtgctgtggtgattagccgtccagttgattgt
agtaaggacaagtgtgctggtggttctagccaagctacaccgtcgaagtctccatcacct
gtgccaactaggccagttcataaaccacaaccaccaaaagaatcaccacaaccaaatgac
ccatataatcagtctccagtgaagtttcggcgtagcccgcctccaccacaacaaccacat
caccatgtggttcactctccaccgccagcttcgtctcctcctacctcaccaccagtccat
tcaactccatcaccggttcacaaaccacaaccaccgaaagagtcaccgcaaccaaatgat
ccatatgatcagtcacctgtgaagttccggcgtagtccacctccacctcctgttcactct
cccccacctccgtcacctattcactcaccaccaccaccaccagtatattctccaccgccc
ccaccaccagtatattctccaccgcccccaccaccggtttattctccaccaccaccacct
ccggtgcattcacctccaccgccagtacactctcctccaccgccagtgcattctccacca
ccgccagtccattcaccgcccccaccggtacattctccaccgccaccagtccattcacct
ccaccaccagtttattctccaccgccaccgcccgtacattctcctccaccgccagtccat
tcaccaccgcctccagtccactctcctccaccaccagtctattctccaccgccaccaccg
ccggtccattcaccacctccaccagtgttctctccaccaccacctgtccactcccctcca
ccgccagtatattccccaccaccaccagtatattctccacctccgccgccagtaaagtca
ccaccaccaccaccagtctactctcctccacttttaccaccaaagatgagttcaccacca
acacaaacaccggtcaactctcctccaccacgaacaccctcacagacagtagaagcacca
ccgccaagtgaggaattcatcattccaccattcatcggccaccaatatgcttcaccacca
cctccaatgttccaaggctactaa

DBGET integrated database retrieval system