KEGG   Arabidopsis thaliana (thale cress): AT2G16120Help
Entry
AT2G16120         CDS       T00041                                 

Gene name
PMT1
Definition
(RefSeq) polyol/monosaccharide transporter 1
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: Sugar_tr MFS_1
Motif
Other DBs
NCBI-GeneID: 816109
NCBI-ProteinID: NP_179209
MIPS: AT2G16120.1
TAIR: AT2G16120
Araport: AT2G16120
UniProt: Q9XIH7
Position
2
AA seq 511 aa AA seqDB search
MNSSGVEQGVVIAESEPPRGNRSRYAFACAILASMTSIILGYDIGVMSGASIFIKDDLKL
SDVQLEILMGILNIYSLVGSGAAGRTSDWLGRRYTIVLAGAFFFCGALLMGFATNYPFIM
VGRFVAGIGVGYAMMIAPVYTAEVAPASSRGFLTSFPEIFINIGILLGYVSNYFFSKLPE
HLGWRFMLGVGAVPSVFLAIGVLAMPESPRWLVLQGRLGDAFKVLDKTSNTKEEAISRLD
DIKRAVGIPDDMTDDVIVVPNKKSAGKGVWKDLLVRPTPSVRHILIACLGIHFAQQASGI
DAVVLYSPTIFSKAGLKSKNDQLLATVAVGVVKTLFIVVGTCVVDRFGRRALLLTSMGGM
FLSLTALGTSLTVINRNPGQTLKWAIGLAVTTVMTFVATFSIGAGPVTWVYCSEIFPVRL
RAQGASLGVMLNRLMSGIIGMTFLSLSKGLTIGGAFLLFAGVAAAAWVFFFTFLPETRGI
PLEEMETLFGSYTANKKNNSMSKDNEVVDGQ
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgaattcctcgggagttgaacaaggtgttgtgattgcggagtcagagccaccgaggggg
aatagaagccgatatgcttttgcttgtgcaatcttagcctccatgacttctatcatcctt
ggttacgacattggagtgatgagtggagcttcaattttcataaaagacgatttgaaactg
tctgatgtacaacttgagattcttatgggaattctaaacatctactctctggtcggttcc
ggcgcagctggtagaacttctgattggctcggaagacgatatacaatagtgttggcagga
gccttcttcttttgcggagccctactaatgggctttgccacaaactaccctttcataatg
gttggccgttttgtagccggtatcggtgttggttatgctatgatgattgcgcctgtttac
accgctgaagtcgctcccgcctcttcccgaggcttccttacctctttccctgagattttt
atcaatattggtatacttttgggatacgtatccaattacttcttctccaagcttcccgag
cacctcggatggaggttcatgttaggtgtaggagcggttccctcggtgttcctagccatt
ggagtgttggcaatgccggagtctcctcggtggctcgtccttcagggtcgtctcggggat
gcttttaaagtccttgacaaaacctccaacaccaaagaagaagctatctctaggctcgat
gacatcaaacgcgcagttggaatccccgatgatatgacagacgatgttatagtcgttccg
aataaaaagagcgctggaaaaggcgtgtggaaggaccttctcgttcgaccaaccccgtcc
gttcgacacatcctcatagcatgccttggtattcatttcgcccagcaagcctctggaatt
gatgcggttgtgctttactctccgacaatcttctcaaaggctggactgaagtccaagaat
gaccagctcttggctacggtcgctgtcggagttgtcaagactctcttcatcgtggtaggg
acttgtgtggtggatcggttcggacgtcgtgccttgttgcttacgagtatgggcggaatg
tttctttccttgaccgcacttggaactagtctcacggtgatcaacaggaaccccgggcaa
acactcaagtgggctatagggctcgccgttacgacggtgatgacttttgtggcaacattc
tcaataggtgcaggccccgtgacgtgggtctactgctcagagatattccctgtgaggcta
agagctcaaggggcaagtttaggagtgatgttgaatagactaatgagtggtattattgga
atgacattcctatctctttctaaaggtctcaccatcggcggtgcgttccttctattcgcc
ggagttgctgccgccgcatgggtcttcttcttcactttcctcccggagacacgtggtata
cctctagaggagatggagactctcttcgggagctacaccgcaaacaagaagaataattct
atgagcaaagacaatgaagttgtggatggacaatga

DBGET integrated database retrieval system