KEGG   Arabidopsis thaliana (thale cress): AT2G17010
Entry
AT2G17010         CDS       T00041                                 

Name
(RefSeq) Mechanosensitive ion channel family protein
  KO
K22048  mechanosensitive ion channel protein 4/5/6/7/8/9/10
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
KEGG Orthology (KO) [BR:ath00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ath02000]
    AT2G17010
Transporters [BR:ath02000]
 Other transporters
  Pores ion channels [TC:1]
   AT2G17010
SSDB
Motif
Pfam: MS_channel DUF2905 Telomerase_RBD
Other DBs
NCBI-GeneID: 816204
NCBI-ProteinID: NP_001318236
TAIR: AT2G17010
UniProt: F4IME2 A0A654ETH4
Position
2:complement(join(7392914..7393205,7393279..7393481,7393562..7393855,7393954..7394077,7394157..7395970))
AA seq 908 aa
MDFRNSFKSHSSYKQIRSPGDQSEPSPEHLPILHDHHPDHSGMVVDDQKPDSTRSSLDDG
RNAPVERDASYKFWQDNTTGTSTDHTAVRTSDKDPIAISRKGDRLSGSFDFVHGKLPVDE
SPTKMVAGEPVNRQWRGRNNEEITLDVDQENDDVSHQTMPTPTSTARTSFDASREMRVSF
NVRRAGGAFVAGSVPSSSSHSSSSSSATMRTNQDQPQLQEEEVVRCTSNMSFQRKSELIS
RVKTRSRLQDPPREEETPYSGWRSGQLKSGLLADIDEEDDPLAEEDVPDEYKRGKLDAIT
LLQWLSLVAIIAALACSLSIQSWKKVRVWNLHLWKWEVFLLVLICGRLVSGWGIRIVVFF
IERNFLLRKRVLYFVYGVRRAVQNCLWLGLVLLAWHFLFDKKVQRETRSRFLPYVTKILV
CFLLSTILWLIKTLVVKVLASSFHVSTYFDRIQEALFNQYVIETLSGPPMIEMSRIEEEE
ERAQDEIFKMQNAGANLPPDLCAAAFPPGKSGRVMNPKLSPIIPKSTTDNGISMEHLHRM
NHKNISAWNMKRLMKIVRNVSLTTLDEQMLESTYEDESTRQIRSEKEAKAAARKIFKNVE
QRGAKYIYLEDLMRFLREDEAMKTMGLFEGAPENKRISKSALKNWLVNAFRERRALALTL
NDTKTAVNKLHHMINIVTAIVIVVIWLVLLEIASSKVLLFVSSQVVLLAFIFGNTVKTVF
ESIIFLFIVHPYDVGDRCEIDSVQLVVEEMNILTTVFLRYDNLKIMYPNSLLWQKSINNY
YRSPDMGDAIEFCVHITTPLEKISVIKQRISNYIDNKPEYWYPQAKIIVKDLEDLHIVRL
AIWPCHRINHQDMAERWTRRAVLVEEVIKILLELDIQHRFYPLDINVRTMPTVVSSRVPP
GWSQNQPA
NT seq 2727 nt   +upstreamnt  +downstreamnt
atggatttcagaaattccttcaaatctcatagctcatacaaacaaattcgaagccccgga
gatcaaagcgagccaagccctgaacatctgccaattctccacgatcaccatcctgatcat
tccggcatggtggtcgatgaccagaaacccgacagcactcgttctagcctcgacgatggt
cgtaacgcgcctgtagaacgtgatgccagttacaaattctggcaagacaacactactgga
acgtcaacggatcacacggcggtgagaacaagtgataaagatccaatcgctattagtcga
aaaggcgatagattaagcggtagtttcgatttcgtgcacgggaagctaccggttgatgaa
tctccaacgaaaatggtcgctggagagcctgtgaatcggcaatggagaggtagaaataat
gaagagatcacacttgatgttgatcaagaaaatgatgatgtaagtcaccaaacaatgcct
acgcctacatcaacggctcgaacctcgtttgatgcgtctagagaaatgcgagtctctttt
aacgttcgtagagcgggtggtgcgtttgtcgctggttcggttccttcttcgtcttcccat
tcgtcttcttcttcgtccgcgacaatgcggacgaatcaggatcagccgcaactgcaggag
gaagaggttgtgagatgtacttcgaacatgtcgtttcagaggaaatcagagcttatatct
agagtgaagacaaggtctaggcttcaagatccgccacgtgaggaagaaacgccttactcg
ggttggagatcgggtcagttgaaatccgggttacttgcggatattgatgaagaggatgat
ccattagcggaagaagatgtaccagatgagtataaaagagggaagcttgacgccattaca
ttgctccagtggcttagcttagtcgctattatagctgcattagcgtgtagtttgtcgatt
cagtcttggaagaaagttagagtttggaatcttcatctatggaaatgggaagtgttcttg
ttggttcttatatgtgggaggttggtttcgggttggggaatccgaatcgttgtcttcttc
atcgagagaaacttccttttgcggaagcgggttctttacttcgtttacggtgtgcgtaga
gctgttcagaactgtctatggctaggcctagtccttctcgcttggcacttcttgttcgac
aagaaagtacagagggagacaaggagcaggtttcttccttacgtaaccaagatcttggtg
tgtttcttgctaagtactatcttgtggttgatcaagacactagtggttaaagttctggcc
tcttcgttccacgtcagtacttactttgatcggattcaagaagcgctctttaaccagtac
gtgatcgagacgttatcgggtcctcccatgattgaaatgagcaggattgaggaagaggaa
gagcgggcgcaagacgagatattcaagatgcagaacgcaggtgctaatttaccaccagat
ctttgcgcggctgcgtttccaccgggaaaaagcgggagagtaatgaatccgaaactctcc
ccgataatcccgaaatcaacaactgataatggaattagcatggaacatcttcacaggatg
aatcataagaacatctctgcttggaacatgaagagactaatgaagattgtgagaaatgtt
tctctgaccacactggacgaacagatgctagaaagcacatacgaagatgaatccacccgc
cagatacgaagcgaaaaagaggctaaagcagctgcaaggaagattttcaagaacgttgag
caacgtggcgcaaagtacatttacctagaggatttgatgagatttttgcgggaagacgag
gcgatgaagaccatgggcctcttcgaaggtgcaccggagaataaaaggatcagcaaatca
gccttaaagaactggctggtcaatgctttcagagagcgacgagctcttgccctgacactc
aacgacaccaagacagcagtgaacaagctccatcacatgattaatattgtcactgccata
gtcattgttgtcatttggcttgtccttcttgaaattgcttcctccaaggtacttctcttt
gtaagttcacaagttgtactcttggccttcatctttgggaacactgtcaagaccgtcttc
gagtccatcatcttcttattcatcgtacacccttacgatgttggtgatcggtgtgagatt
gacagtgtacagttggtggtggaggagatgaacatactcactaccgtgttcttacgatac
gacaatctgaagattatgtatccgaatagtcttttgtggcagaaatcaatcaacaattac
taccgcagtccggatatgggagatgcaatcgagttctgtgtccacattactactcctctt
gaaaaaatctccgtgatcaaacagagaatatcgaactacatcgacaacaagccggagtat
tggtacccacaagccaaaatcattgtaaaagatttggaagatttgcacatagtaagacta
gcaatatggccatgtcacaggattaatcaccaagacatggctgaaagatggacaagaaga
gccgtcttagtcgaagaagtgattaagatactcctcgagctcgacattcaacaccggttt
tatccgctcgatatcaatgtccgaacaatgcctaccgttgtctctagcagagttccacct
ggctggtcacaaaaccaacctgcctga

DBGET integrated database retrieval system