KEGG   Arabidopsis thaliana (thale cress): AT2G17370Help
Entry
AT2G17370         CDS       T00041                                 

Gene name
HMG2
Definition
(RefSeq) 3-hydroxy-3-methylglutaryl-CoA reductase 2
  KO
K00021  hydroxymethylglutaryl-CoA reductase (NADPH) [EC:1.1.1.34]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00900  Terpenoid backbone biosynthesis
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
Module
ath_M00095  C5 isoprenoid biosynthesis, mevalonate pathway
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AT2G17370 (HMG2)
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.34  hydroxymethylglutaryl-CoA reductase (NADPH)
     AT2G17370 (HMG2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HMG-CoA_red
Motif
Other DBs
NCBI-GeneID: 816244
NCBI-ProteinID: NP_179329
MIPS: AT2G17370.1
TAIR: AT2G17370
Araport: AT2G17370
UniProt: P43256 A0A178VRN5
Position
2
AA seq 562 aa AA seqDB search
MEDLRRRFPTKKNGEEISNVAVDPPLRKASDALPLPLYLTNTFFLSLFFATVYFLLSRWR
EKIRNSTPLHVVDLSEICALIGFVASFIYLLGFCGIDLIFRSSSDDDVWVNDGMIPCNQS
LDCREVLPIKPNSVDPPRESELDSVEDEEIVKLVIDGTIPSYSLETKLGDCKRAAAIRRE
AVQRITGKSLTGLPLEGFDYNSILGQCCEMPVGYVQIPVGIAGPLLLDGVEYSVPMATTE
GCLVASTNRGFKAIHLSGGAFSVLVKDAMTRAPVVRFPSARRAALVMFYLQDPSNFERLS
LIFNKSSRFARLQSITCTIAGRNLYPRFACSTGDAMGMNMVSKGVQNVLDFVKSEFPDMD
VIGISGNYCSDKKASAVNWIEGRGKHVVCEAFIKAEIVEKVLKTSVEALVELNTLKNLVG
SAMAGSLGGFNAHSSNIVSAVFIATGQDPAQNVESSHCMTMILPDGDDLHISVSMPCIEV
GTVGGGTQLASQAACLNLLGVKGSNNEKPGSNAQQLARIVAGSVLAGELSLMSAIAAGQL
VKSHMKYNRSSRDIGPSSQVNR
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atggaggatctccgtcgtagatttccgactaaaaagaacggagaagaaatctctaatgtc
gccgtcgatcctcctcttcgtaaagcctctgacgcgcttcctcttccgttatacctaacc
aacacttttttcctctcgctcttcttcgctactgtttattttcttcttagccgatggcgt
gagaagatccgtaactcgacgcctcttcacgtcgttgacttatctgagatctgtgctcta
atcggtttcgttgcttcgtttatctacctccttggtttctgtggtattgatctcattttc
cgatcttcttccgatgatgatgtttgggttaacgatgggatgattccatgtaatcaatcc
ctagattgtcgtgaggttcttccgattaaacctaattccgtcgatcctcctcgggaatcg
gagcttgattcggtggaagatgaagaaatcgttaaattagtgatcgacggaaccatccct
tcgtactcattggagacgaaactcggagattgtaaaagagcagcagcgattagaagagaa
gcggttcagaggataaccggtaaatccttaaccggtcttccattggaaggtttcgattac
aattcaattttggggcaatgctgtgagatgccagttgggtatgttcagatcccagtgggg
attgcaggacctttgttgcttgatggggttgagtattcagtgccaatggctacaacagaa
ggttgtttggttgctagtaccaatagaggttttaaagctatacacttgtctggtggtgct
tttagtgttcttgtgaaagatgccatgactagagctccagttgttagattcccttctgca
agaagagctgctcttgtcatgttttatcttcaagatccttctaatttcgagagattgtct
ctcattttcaacaaatcgagtagatttgctaggcttcagagtattacatgcacgattgct
gggaggaatctgtatccgaggtttgcgtgtagtactggtgatgctatggggatgaacatg
gtctcaaaaggtgttcagaatgtcttggactttgtaaagagcgagtttcctgacatggat
gttattggcatctctgggaactactgttcggacaagaaggcttcggctgtaaactggatc
gaaggacgtggtaagcatgttgtatgtgaagcttttattaaggctgagattgtggagaaa
gtgttgaagactagcgttgaggctcttgtagagcttaacacgctcaagaatcttgttggt
tcagccatggcgggttctcttggtgggttcaatgctcattcaagcaatattgtcagcgct
gtgttcatcgccactggccaagacccagctcaaaacgtggagagctcacactgtatgacc
atgattcttcccgatggtgacgaccttcacatctctgtttcaatgccttgcattgaggtt
ggtactgttggaggtgggacacaacttgcatcacaagcagcttgtttgaatctactcggt
gtgaaaggatcaaacaacgagaaacctggctcgaacgcacagcaattggcaagaatagtg
gctggttcggttcttgcaggagagctttcactaatgtctgctattgcagctggacagctt
gtgaagagtcacatgaaatacaacagatccagcagagacattggcccttcgtctcaagtc
aacaggtga

DBGET integrated database retrieval system