KEGG   Arabidopsis thaliana (thale cress): AT2G18640Help
Entry
AT2G18640         CDS       T00041                                 

Gene name
GGPS4
Definition
(RefSeq) geranylgeranyl pyrophosphate synthase 4
  KO
K13789  geranylgeranyl diphosphate synthase, type II [EC:2.5.1.1 2.5.1.10 2.5.1.29]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00900  Terpenoid backbone biosynthesis
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
Module
ath_M00366  C10-C20 isoprenoid biosynthesis, plants
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AT2G18640 (GGPS4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:ath01006]
    AT2G18640 (GGPS4)
Enzymes [BR:ath01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.1  dimethylallyltranstransferase
     AT2G18640 (GGPS4)
    2.5.1.10  (2E,6E)-farnesyl diphosphate synthase
     AT2G18640 (GGPS4)
    2.5.1.29  geranylgeranyl diphosphate synthase
     AT2G18640 (GGPS4)
Prenyltransferases [BR:ath01006]
 Terpene biosynthesis
  Prenyl diphosphate synthase
   AT2G18640 (GGPS4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: polyprenyl_synt Imm57
Motif
Other DBs
NCBI-GeneID: 816379
NCBI-ProteinID: NP_179454
MIPS: AT2G18640.1
TAIR: AT2G18640
Araport: AT2G18640
UniProt: Q9SLG2
Position
2
AA seq 372 aa AA seqDB search
MEAQNIFLYLLIVFLSLHFVFTTLKGRLSPANTRRLIRLLHIPIKSPVAAAIFARKDTRE
FLDSSIKLVNEEDDFGFSFDFKPYMISKAETINRALDEAIPLIEPLNIHKAMRYAILAGG
KRVRPILCLAACELVGGEERLAIQAACAVEMIHTMSLIKDDLPCMDNDDLRRGKPTTHKV
FGESVAILSGGALLALAFEHLTEADVSSKKMVRAVKELAKSIGTKGLVAGQAKDLSSEGL
EQNDVGLEDLEYIHVHKTGSLLEASAVIGAVIGGGTEKEIEKVRNFARCIGLLFQVVDDI
LDETKSSEELGKTAGKDKVAGKLTYPKVIGVEKSKEFVEKLKRDAREHLQGFDSDKVKPL
IALTNFIANRNH
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atggaagctcaaaatatctttctctatcttttgatcgtctttctatctctacacttcgtg
tttacaactctgaaaggacggctgagtcccgcgaatacacggcggcttatccgccttctc
catatcccgatcaaatctccggtcgccgctgctattttcgctagaaaagacacccgtgag
tttcttgattcatcaatcaaattagtaaacgaagaagacgatttcggtttcagtttcgat
ttcaaaccgtacatgatcagcaaagcagagacaataaacagagcattagatgaagcaatt
ccacttattgagccactcaacatccacaaggcaatgcgttacgcgattctcgcaggcgga
aaacgtgtcaggccaatactctgcctagccgcttgcgagctagtcggcggggaagagcgt
ttagcgattcaagcggcttgtgcagttgaaatgattcacacaatgtcactcatcaaagac
gatcttccttgtatggacaacgacgatctccgacgagggaaaccaacaacacataaagtc
ttcggagaaagcgtagccatactctccggcggcgcacttttagctctagctttcgagcat
ttgacggaagctgacgtgtcatccaagaaaatggttcgagccgttaaagaattggctaag
tctattggaacgaaaggactcgtagcgggacaggcgaaggatttaagcagtgaagggttg
gaacaaaacgatgtcggattagaggatcttgaatatattcacgttcataaaaccggttcg
ttgcttgaagcatctgcggttatcggagcggttataggcggtggaacagagaaagagata
gagaaagtgagaaactttgcgaggtgtatcggattgttgtttcaggtggttgatgatatc
ttggatgagaccaagtcgtcggaggaattgggaaaaaccgccggaaaagataaggtcgcc
ggaaagctgacgtatccaaaagtgattggtgttgagaaatctaaggagtttgtggagaag
ttgaagagagatgcgagagaacatcttcaagggtttgattctgacaaagtcaaacctttg
atagctcttactaacttcattgccaacagaaaccactga

DBGET integrated database retrieval system