KEGG   Arabidopsis thaliana (thale cress): AT2G19490Help
Entry
AT2G19490         CDS       T00041                                 

Gene name
RECA2
Definition
(RefSeq) recA DNA recombination family protein
  KO
K03553  recombination protein RecA
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ath00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    AT2G19490 (RECA2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ath03400]
    AT2G19490 (RECA2)
DNA repair and recombination proteins [BR:ath03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     AT2G19490 (RECA2)
    RecFOR pathway proteins
     AT2G19490 (RECA2)
  TLS (translesion DNA synthesis) factors
   Other SOS response factors
    AT2G19490 (RECA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RecA Rad51 ATPase ATPase_2 ABC_tran AAA_25 AAA_24 AAA AAA_22 AAA_16 AAA_35 CobU AAA_14 AAA_33 AAA_23 TK CLP1_P DUF3891
Motif
Other DBs
NCBI-GeneID: 816468
NCBI-ProteinID: NP_179539
MIPS: AT2G19490.1
TAIR: AT2G19490
Araport: AT2G19490
UniProt: Q9ZUP2 A0A178VN76
Position
2
AA seq 430 aa AA seqDB search
MARILRNVYSLRSSLFSSELLRRSVVGTSFQLRGFAAKAKKKSKSDGNGSSEEGMSKKEI
ALQQALDQITSSFGKGSIMYLGRAVSPRNVPVFSTGSFALDVALGVGGLPKGRVVEIYGP
EASGKTTLALHVIAEAQKQGGTCVFVDAEHALDSSLAKAIGVNTENLLLSQPDCGEQALS
LVDTLIRSGSVDVIVVDSVAALVPKGELEGEMGDAHMAMQARLMSQALRKLSHSLSLSQT
LLIFINQVRSKLSTFGGFGGPTEVTCGGNALKFYASMRLNIKRIGLIKKGEETTGSQVSV
KIVKNKLAPPFRTAQFELEFGKGICKITEIIDLSIKHKFIAKNGTFYNLNGKNYHGKEAL
KRFLKQNESDQEELMKKLQDKLIADEAADKETESESEEEDSLRVVVSPDNTDDESPALVV
GAAAVVVEAA
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atggcgaggattctccgaaacgtttattcactgagaagctctctgttttcgtcagagtta
cttagaagaagtgtggttggaacatcgtttcagctccgaggctttgctgccaaagctaaa
aagaaatccaagtcagatggaaatggatcatctgaagaaggtatgtcgaaaaaggagatt
gctcttcagcaagcacttgatcagattaccagttcatttggcaaagggtccataatgtat
ctcggtcgtgctgtttctcctagaaatgtcccggttttctctaccggatcttttgccctt
gatgtagctttgggagttggtggccttcctaaggggcgtgttgtggagatatatggtcct
gaagcatcgggaaagacaacacttgctcttcatgttattgcagaagcacaaaaacaagga
ggaacctgtgtctttgtagatgctgagcatgctcttgattcgtcacttgctaaggcaatc
ggtgtaaatacagaaaatctgcttctatcacagcctgattgtggcgaacaggcccttagt
cttgtggatactttaatccgaagtggttcagttgatgttattgtagttgacagtgtggct
gctcttgtacctaaaggagaacttgagggcgagatgggtgatgcacatatggctatgcaa
gccagattgatgagccaagctttgcgtaaattgagccattctttatcgttatcgcaaaca
cttctgatctttataaatcaggtgagatcaaaactatctacgtttggaggatttggaggt
ccaacagaagttacttgtggtggaaatgctttgaagttttatgcttctatgcgtttgaat
atcaagcgaattggacttatcaagaaaggcgaagagacaacgggaagtcaagtctccgtg
aagatagtgaagaacaaactcgctccgccgtttagaactgctcagtttgagcttgaattc
ggcaaaggaatctgcaagatcacggagataatcgacctgagcataaagcacaagttcatc
gcgaaaaacggaacattctacaatctcaacggtaaaaactaccatggaaaagaggcttta
aagagattccttaaacagaacgaatctgatcaagaagagctcatgaagaagctccaagac
aagctcatcgccgatgaagctgcagataaggaaactgaatctgaatctgaggaagaagat
tccctgagagttgtggtttcacctgacaacacagatgatgaatcaccagctcttgttgtt
ggagctgctgcagtggttgttgaggcagcatga

DBGET integrated database retrieval system