KEGG   Arabidopsis thaliana (thale cress): AT2G19940
Entry
AT2G19940         CDS       T00041                                 
Name
(RefSeq) Putative N-acetyl-gamma-glutamyl-phosphate reductase
  KO
K00145  N-acetyl-gamma-glutamyl-phosphate reductase [EC:1.2.1.38]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00220  Arginine biosynthesis
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
ath01210  2-Oxocarboxylic acid metabolism
ath01230  Biosynthesis of amino acids
Module
ath_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    AT2G19940
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.38  N-acetyl-gamma-glutamyl-phosphate reductase
     AT2G19940
SSDB
Motif
Pfam: Semialdhyde_dh Semialdhyde_dhC NAD_binding_10 Sacchrp_dh_NADP DapB_N
Other DBs
NCBI-GeneID: 816513
NCBI-ProteinID: NP_849993
TAIR: AT2G19940
UniProt: Q93Z70
Structure
Position
2:8612926..8616117
AA seq 401 aa
MSTASAFSSIQGCWFKGERKIXVADKRAKRLTLGSHVASPSSMSFRVSASSSVKPEKDIR
IGLLGASGYTGAEIVRLLANHPHFQVTLMTADRKAGQSMESVFPHLRAQKLPTLVSVKDA
DFSTVDAVFCCLPHGTTQEIIKELPTALKIVDLSADFRLRNIAEYEEWYGQPHKAVELQK
EVVYGLTEILREDIKKARLVANPGCYPTTIQLPLVPLLKANLIKHENIIIDAKSGVSGAG
RGAKEANLYSEIAEGISSYGVTRHRHVPEIEQGLSDVAQSKVTVSFTPHLMPMIRGMQST
IYVEMAPGVRTEDLHQQLKTSYEDEEFVKVLDEGVVPRTHNVRGSNYCHMSVFPDRIPGR
AIIISVIDNLVKGASGQALQNLNIMLGYPETTGLLHQPLFP
NT seq 1205 nt   +upstreamnt  +downstreamnt
atgagtactgcgtcggcttttagttcaatccaaggatgctggttcaagggcgaaaggaaa
attgtgtagcggataagcgagccaagaggcttactttgggatcccatgtggcttcgccat
cttcaatgagcttcagagtttcagctagtagttctgttaaacctgaaaaggatattagga
ttggtcttcttggtgcaagtggctacactggtgctgagatcgttaggcttcttgcaaatc
atccgcatttccaggtcactttgatgactgctgatagaaaagctggccagtcaatggaaa
gcgttttcccacacctgagagctcaaaaactacctactttggtctcggtaaaggatgcag
atttttctactgtggatgctgtattctgctgtttacctcacggaacaactcaggaaatca
tcaaggaactgcctactgcattgaaaatcgttgatctttcagcggacttccggttgcgta
atattgcagaatatgaagaatggtatggtcagcctcacaaggcagtagagttacagaaag
aagttgtgtatggtctaacagagatactaagggaggacataaaaaaggcacgacttgtgg
ctaacccaggctgttacccgactacgattcaacttcctcttgttcctttactaaaggcaa
atctcatcaaacatgaaaacatcattatcgatgcaaaatctggtgttagtggagcaggac
gtggtgctaaggaggcaaatctttactctgagatagctgaaggcatttcttcttatggtg
tcacccgtcatcgccatgttcctgaaattgaacagggattatctgatgttgcacagtcaa
aagtaacagtcagttttacgccacatctcatgccaatgatccgtggaatgcaatcgacta
tatatgtggaaatggctcccggggttagaaccgaagatttacaccagcaattgaagacgt
cttatgaggatgaagaatttgtcaaagtgttggatgaaggagttgttcctcggacacaca
acgttagaggatccaactattgtcatatgagtgtctttcctgatcgaattcctggaagag
ctatcataatctcagtgattgataatcttgtgaaaggagcttcgggacaagcgttgcaga
atcttaacataatgttgggatatcccgaaacaacggggctcctacaccagccgcttttcc
cttaa

DBGET integrated database retrieval system