KEGG   Arabidopsis thaliana (thale cress): AT2G20340Help
Entry
AT2G20340         CDS       T00041                                 

Gene name
AAS
Definition
(RefSeq) Pyridoxal phosphate (PLP)-dependent transferases superfamily protein
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00350  Tyrosine metabolism
ath00360  Phenylalanine metabolism
ath00380  Tryptophan metabolism
ath00901  Indole alkaloid biosynthesis
ath00950  Isoquinoline alkaloid biosynthesis
ath00965  Betalain biosynthesis
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    AT2G20340 (AAS)
   00360 Phenylalanine metabolism
    AT2G20340 (AAS)
   00380 Tryptophan metabolism
    AT2G20340 (AAS)
  09110 Biosynthesis of other secondary metabolites
   00901 Indole alkaloid biosynthesis
    AT2G20340 (AAS)
   00950 Isoquinoline alkaloid biosynthesis
    AT2G20340 (AAS)
   00965 Betalain biosynthesis
    AT2G20340 (AAS)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ath04147]
    AT2G20340 (AAS)
Enzymes [BR:ath01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     AT2G20340 (AAS)
    4.1.1.105  L-tryptophan decarboxylase
     AT2G20340 (AAS)
Exosome [BR:ath04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AT2G20340 (AAS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase Aminotran_1_2 RBD
Motif
Other DBs
NCBI-GeneID: 816553
NCBI-ProteinID: NP_849999
MIPS: AT2G20340.1
TAIR: AT2G20340
Araport: AT2G20340
UniProt: Q8RY79 F6L7A0
Structure
PDB: 

Position
2
AA seq 490 aa AA seqDB search
MENGSGKVLKPMDSEQLREYGHLMVDFIADYYKTIEDFPVLSQVQPGYLHKLLPDSAPDH
PETLDQVLDDVRAKILPGVTHWQSPSFFAYYPSNSSVAGFLGEMLSAGLGIVGFSWVTSP
AATELEMIVLDWVAKLLNLPEQFMSKGNGGGVIQGSASEAVLVVLIAARDKVLRSVGKNA
LEKLVVYSSDQTHSALQKACQIAGIHPENCRVLTTDSSTNYALRPESLQEAVSRDLEAGL
IPFFLCANVGTTSSTAVDPLAALGKIANSNGIWFHVDAAYAGSACICPEYRQYIDGVETA
DSFNMNAHKWFLTNFDCSLLWVKDQDSLTLALSTNPEFLKNKASQANLVVDYKDWQIPLG
RRFRSLKLWMVLRLYGSETLKSYIRNHIKLAKEFEQLVSQDPNFEIVTPRIFALVCFRLV
PVKDEEKKCNNRNRELLDAVNSSGKLFMSHTALSGKIVLRCAIGAPLTEEKHVKEAWKII
QEEASYLLHK
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atggaaaatggaagcgggaaggtgttgaagccgatggactcagagcaattgagagagtac
ggacatctgatggttgatttcattgctgattactacaaaaccatcgaagatttccctgtt
cttagccaagttcagcctggttatcttcataagcttttgcctgattctgcacctgaccac
cctgaaactctggaccaagttcttgatgatgttcgagcaaagatattgcctggagtaacg
cattggcaaagcccgagtttctttgcttattatccttctaacagcagtgttgctgggttc
ttgggtgagatgttgagtgctggtcttggcattgttggttttagttgggttacttctcca
gctgccacagagctagaaatgatcgttcttgattgggttgctaaacttctcaacctaccc
gagcagtttatgtccaaaggaaatggaggtggagttatacaagggtcagctagtgaagct
gttcttgttgttctgattgctgcacgcgacaaggttttaagaagcgttggcaaaaacgcg
cttgagaagctcgttgtctactcctctgaccagactcattcagctttacagaaggcttgc
cagattgctggaatccatccagagaattgcagggtgctgacaacagactcttctacaaat
tacgctctgcgtccagaatcgcttcaagaagctgtttctagggatcttgaagctggattg
attccattcttcttatgtgctaatgttgggaccacttcttcaaccgcagttgatccatta
gctgcactggggaagattgctaatagcaatggaatttggtttcacgtggatgcagcatat
gctggaagtgcctgtatatgtccagagtatcggcaatacattgacggtgtagaaactgca
gactcttttaacatgaatgctcacaaatggttcctcactaacttcgattgttcccttctt
tgggtaaaggatcaagattctcttacattagctctttcaacaaatccagagtttctcaaa
aacaaggcctctcaggcaaacttggttgttgattacaaagattggcaaatccctctcgga
cgaagattcagatcattgaaactatggatggttttaaggctctatggatctgagaccttg
aagagctatataagaaaccatatcaaactggctaaagaattcgaacaacttgtctctcaa
gatcctaacttcgagattgtcacacctcggatctttgctcttgtctgtttccgcctcgtg
cctgtgaaagacgaagaaaagaagtgtaataaccgaaaccgtgaactcctagacgcagtg
aactcttcagggaaactcttcatgtcgcacactgctttatcggggaaaatcgtactacgt
tgcgcaataggagcgccattgacggaggagaagcacgttaaggaggcgtggaagattatt
caggaagaagcatcttacttgcttcacaagtaa

DBGET integrated database retrieval system