KEGG   Arabidopsis thaliana (thale cress): AT2G20370Help
Entry
AT2G20370         CDS       T00041                                 

Gene name
MUR3
Definition
(RefSeq) Exostosin family protein
  KO
K20888  xyloglucan galactosyltransferase MUR3 [EC:2.4.1.-]
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
KEGG Orthology (KO) [BR:ath00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:ath01003]
    AT2G20370 (MUR3)
Enzymes [BR:ath01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.-  
     AT2G20370 (MUR3)
Glycosyltransferases [BR:ath01003]
 Polysaccharide
  Structural polysaccharide
   AT2G20370 (MUR3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Exostosin Cut8
Motif
Other DBs
NCBI-GeneID: 816556
NCBI-ProteinID: NP_179627
MIPS: AT2G20370.1
TAIR: AT2G20370
Araport: AT2G20370
UniProt: Q7XJ98
Position
2
AA seq 619 aa AA seqDB search
MFPRVSMRRRSAEVSPTEPMEKGNGKNQTNRICLLVALSLFFWALLLYFHFVVLGTSNID
KQLQLQPSYAQSQPSSVSLRVDKFPIEPHAAPSKPPPKEPLVTIDKPILPPAPVANSSST
FKPPRIVESGKKQEFSFIRALKTVDNKSDPCGGKYIYVHNLPSKFNEDMLRDCKKLSLWT
NMCKFTTNAGLGPPLENVEGVFSDEGWYATNQFAVDVIFSNRMKQYKCLTNDSSLAAAIF
VPFYAGFDIARYLWGYNISRRDAASLELVDWLMKRPEWDIMRGKDHFLVAGRITWDFRRL
SEEETDWGNKLLFLPAAKNMSMLVVESSPWNANDFGIPYPTYFHPAKDSEVFEWQDRMRN
LERKWLFSFAGAPRPDNPKSIRGQIIDQCRNSNVGKLLECDFGESKCHAPSSIMQMFQSS
LFCLQPQGDSYTRRSAFDSMLAGCIPVFFHPGSAYTQYTWHLPKNYTTYSVFIPEDDVRK
RNISIEERLLQIPAKQVKIMRENVINLIPRLIYADPRSELETQKDAFDVSVQAVIDKVTR
LRKNMIEGRTEYDYFVEENSWKYALLEEGQREAGGHVWDPFFSKPKPGEDGSSDGNGGTT
ISADAAKNSWKSEQRDKTQ
NT seq 1860 nt NT seq  +upstreamnt  +downstreamnt
atgtttccaagggtttctatgaggcgtcgctctgctgaagtttctcctacagagccaatg
gagaagggaaatggaaaaaatcagactaatcgaatctgtttgttggttgctttgtcactc
tttttctgggcattgttgttgtacttccattttgttgtcttagggactagtaacattgat
aaacagctccaattgcaacctagttatgctcaatctcagccatcatcagtctctcttcgt
gttgataaattccctatagagcctcatgcagctccatcgaaaccacctcccaaagagcct
ttagttactatcgataagccaatactccctcctgcaccagtagccaattctagttccacc
tttaagccacctagaattgttgagagcgggaagaaacaggagttttcgtttataagagcc
ttgaagacagtagacaacaagagtgacccttgtggagggaagtacatttatgttcacaat
ctaccctcaaagttcaatgaggatatgcttagagactgtaagaagcttagtctctggact
aacatgtgtaagttcacaaccaatgctggccttgggccgccgcttgagaatgttgaaggt
gtcttctctgatgaaggttggtatgcgactaatcagtttgctgttgatgtgatattcagc
aaccggatgaagcagtacaaatgtttgacaaatgattcttcccttgctgctgccatcttt
gtgccgttctatgctggattcgacattgctaggtatctgtggggatacaatatctcgaga
agggatgctgcttcgcttgagttggtcgattggctcatgaagcggcctgagtgggatata
atgaggggaaaagatcatttccttgtggcgggtaggataacgtgggattttaggagattg
tctgaagaagaaactgattggggcaacaagcttctcttcttaccggctgccaagaacatg
tctatgcttgtggttgagtcgagcccatggaatgctaatgattttgggatcccgtaccca
acctacttccacccagcaaaggactcagaggtttttgaatggcaagaccggatgagaaac
ctggaaaggaagtggcttttctcgtttgcaggagccccacgacctgacaatccgaaatct
atcagagggcagatcattgatcaatgtcgaaactcaaatgttggcaaattattagaatgc
gattttggggagagcaaatgccatgcaccaagcagcattatgcaaatgtttcaaagctct
ctcttctgcctgcagccacagggagactcttacacccgaagatcggcatttgactcaatg
cttgccggttgtataccggtcttcttccatccgggttcagcctacacgcaatacacgtgg
catctacccaagaactacacaacctactcggtattcatccccgaggatgatgttcggaag
agaaacataagcatcgaggagcgactcctccagattccagccaagcaggtcaagataatg
agagagaatgtcatcaacctcatcccaaggctgatctacgcagacccgagatcagaactg
gagacgcagaaagatgcatttgatgtctcggtacaggctgtgatagacaaggtgactcgg
ttaaggaagaacatgatcgagggccgaaccgagtatgactacttcgtggaggagaacagc
tggaagtatgcgttgctggaggaaggccaacgggaagcagggggccatgtgtgggacccg
ttcttctccaaaccaaagcccggagaagatggcagcagcgatggtaatggaggcacgact
atttcagcagatgcagctaagaattcatggaagagtgagcagagagataagacacagtga

DBGET integrated database retrieval system