KEGG   Arabidopsis thaliana (thale cress): AT2G20420Help
Entry
AT2G20420         CDS       T00041                                 

Definition
(RefSeq) ATP citrate lyase (ACL) family protein
  KO
K01900  succinyl-CoA synthetase beta subunit [EC:6.2.1.4 6.2.1.5]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00020  Citrate cycle (TCA cycle)
ath00640  Propanoate metabolism
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
ath01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AT2G20420
   00640 Propanoate metabolism
    AT2G20420
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ath04147]
    AT2G20420
Enzymes [BR:ath01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     AT2G20420
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     AT2G20420
Exosome [BR:ath04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AT2G20420
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 Succ_CoA_lig Citrate_bind
Motif
Other DBs
NCBI-GeneID: 816561
NCBI-ProteinID: NP_179632
MIPS: AT2G20420.1
TAIR: AT2G20420
Araport: AT2G20420
UniProt: O82662
Position
2
AA seq 421 aa AA seqDB search
MRGLVNKLVSRSLSISGKWQNQQLRRLNIHEYQGAELMGKYGVNVPKGVAASSLEEVKKA
IQDVFPNESELVVKSQILAGGRGLGTFKSGLKGGVHIVKRDEAEEIAGKMLGQVLVTKQT
GPQGKVVSKVYLCEKLSLVNEMYFSIILDRKSAGPLIIACKKGGTSIEDLAEKFPDMIIK
VPIDVFAGITDEDAAKVVDGLAPKAADRKDSIEQVKKLYELFRKTDCTMLEINPLAETST
NQLVAADAKLNFDDNAAFRQKEVFAMRDPTQEDPREVAAAKVDLNYIGLDGEIGCMVNGA
GLAMATMDIIKLHGGTPANFLDVGGNASEHQVVEAFKILTSDDKVKAILVNIFGGIMKCD
VIASGIVNAAKEVALKVPVVVRLEGTNVEQGKRILKESGMKLITADDLDDAAEKAVKALA
H
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgaggggattggtgaacaagctcgtgtccagatctctctccatctccgggaaatggcag
aaccaacagcttcgtcgtctcaacatccacgagtatcagggagctgaattgatggggaaa
tatggagttaatgtgccgaaaggagtagctgcttcttcgttggaagaagttaaaaaggct
attcaagatgttttccctaatgaaagcgagttggttgttaagagccagattttggctggt
ggaagaggtcttggaacattcaagagtggtcttaagggtggtgttcacattgttaaacgt
gatgaggctgaagagattgctggaaagatgctaggacaagtacttgtcaccaagcaaact
ggtcctcaaggcaaagtagttagcaaggtttacttgtgtgagaaattgtcactcgtcaat
gagatgtacttttccattattctggaccgtaaatctgctggaccgttgatcattgcctgt
aaaaagggtggtaccagtattgaagatcttgctgagaagttccctgacatgatcatcaag
gtaccaattgatgtatttgcaggaatcactgatgaagatgctgctaaggttgtggatggt
ctggctcccaaagctgctgacagaaaagattcgattgaacaagtgaagaagctatacgaa
ctcttccgcaagactgactgcacaatgttggaaatcaatccccttgcggagacatcaact
aatcaattggtagctgctgatgccaaattgaacttcgatgataatgctgcgttccgacaa
aaagaggttttcgccatgcgtgatccaacacaggaggatccacgagaggtggctgctgct
aaagttgacctgaactacatcggtttagatggagagattggttgcatggtgaatggtgct
ggattggccatggcaaccatggacatcattaaattacacggtggaacacccgccaatttc
cttgacgttggtggaaatgcttctgagcaccaggtggtggaagcgtttaagatactgaca
tcggacgataaagtgaaagcaatcttggtgaacatatttggtgggataatgaaatgtgat
gtgattgctagtggaatcgtgaacgctgcaaaagaggtcgcattgaaagtgccagtggtg
gttcgtctagaaggaacgaatgttgagcagggaaagagaatcctcaaggaaagtggaatg
aaactcataacagctgatgatttggatgatgcagctgagaaagcggttaaagctttagct
cactaa

DBGET integrated database retrieval system