KEGG   Arabidopsis thaliana (thale cress): AT2G21230
Entry
AT2G21230         CDS       T00041                                 

Definition
(RefSeq) Basic-leucine zipper (bZIP) transcription factor family protein
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf MPS2 ATG16
Other DBs
NCBI-GeneID: 816660
NCBI-ProteinID: NP_001318259
MIPS: AT2G21230.1
TAIR: AT2G21230
UniProt: B3H7M2
Position
2
AA seq 525 aa
MGGGGDTTDTNMMQRVNSSSGTSSSSIPKHNLHLNPALIRSHHHFRHPFTGAPPPPIPPI
SPYSQIPATLQPRHSRSMSQPSSFFSFDSLPPLNPSAPSVSVSVEEKTGAGFSPSLPPSP
FTMCHSSSSRNAGDGENLPPRKSHRRSNSDVTFGFSSMMSQNQKSPPLSSLERSISGEDT
SDWSNLVKKEPREGFYKGRKPEVEAAMDDVFTAYMNLDNIDVLNSFGGEDGKNGNENVEE
MESSRGSGTKKTNGGSSSDSEGDSSASGNVKVALSSSSSGVKRRAGGDIAPTGRHYRSVS
MDSCFMGKLNFGDESSLKLPPSSSAKVSPTNSGEGNSSAYSVEFGNSEFTAAEMKKIAAD
EKLAEIVMADPKRVKRILANRVSAARSKERKTRYMAELEHKVQTLQTEATTLSAQLTHLQ
RDSMGLTNQNSELKFRLQAMEQQAQLRDGMHIIKTLSEKLNEEVQRLKLVIGEPNRRQSG
SSSSESKMSLNPEMFQQLSISQLQHQQMQHSNQCSTMKAKHTSND
NT seq 1578 nt   +upstreamnt  +downstreamnt
atgggtggtggtggtgatacaacagataccaatatgatgcagagagttaattcttcttct
ggtacatcgtcttcttcgatccctaaacacaatcttcacttgaatcctgctcttatccgc
tctcaccatcacttccgtcaccctttcaccggagctcctccaccgccgattccacccatt
tctccttactctcagatcccggcgactttacaacctagacattctcgctctatgtcgcaa
ccgtcttctttcttctcctttgattcattgccgccgttaaatccttctgctccgtcggtt
tcggtgtcggtggaggagaaaaccggtgccggatttagtccttcgttgcctccgtcaccg
tttacgatgtgtcattcttctagctctaggaacgccggagatggagagaatctacctccg
agaaagtcgcataggcgttcgaatagtgatgttacttttgggtttagttcaatgatgtct
cagaatcaaaagtctcctcctttgagttctttggagagatcgatctctggtgaagataca
tcagattggtctaatttggtgaagaaagaaccgagagaaggcttctacaagggaagaaaa
ccagaggttgaagcagctatggacgatgttttcacggcttatatgaatcttgataacatt
gatgtcttgaattcttttggaggtgaagatggcaagaatgggaatgagaatgtggaggag
atggagagtagtagaggtagtggtacaaagaagacgaatggtggaagtagtagtgattct
gaaggagatagcagtgcgagtgggaatgtgaaggttgcgttgagttcttcttcttcaggc
gtgaagagaagagcaggtggagatattgctcctactggtagacattacaggagtgtttct
atggacagttgtttcatggggaagttgaatttcggcgacgaatcatcgctaaagcttccg
ccttcttcatcagctaaagtttccccaaccaattcaggtgaagggaattcaagtgcttat
agtgttgaatttggaaacagtgagtttactgcagctgaaatgaagaagattgcagctgat
gagaaactcgctgagattgtaatggctgaccctaagcgtgttaaaagaatcttggcgaac
cgcgtatctgctgcacgttcaaaggagcggaagacgcgatacatggcagagttggaacac
aaggtgcagacacttcagactgaagctactacattatcggctcagctcacacatttgcag
agagattctatggggttgacaaaccagaacagtgagctgaagtttcgtcttcaagctatg
gagcagcaagcacaactccgcgatggtatgcacattatcaaaactctgtcagagaaactg
aatgaagaagtccagcggttgaaactggtgataggggagccgaaccgcaggcaaagtggg
agcagcagcagcgaatcaaagatgtcactaaacccggagatgtttcagcagcttagcata
agtcagttacaacaccaacagatgcagcattccaatcagtgtagcacaatgaaagcaaag
cacacttcaaacgactag

DBGET integrated database retrieval system