KEGG   Arabidopsis thaliana (thale cress): AT2G21290
Entry
AT2G21290         CDS       T00041                                 
Name
(RefSeq) 30S ribosomal protein S31
  KO
K19033  30S ribosomal protein S31
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
KEGG Orthology (KO) [BR:ath00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:ath03011]
    AT2G21290
Ribosome [BR:ath03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Small subunit
    AT2G21290
  Bacteria
    AT2G21290
SSDB
Motif
Pfam: RPS31 Thx
Other DBs
NCBI-GeneID: 816668
NCBI-ProteinID: NP_565506
TAIR: AT2G21290
UniProt: Q9SJU8 A0A178VPU6
Structure
Position
2:9112798..9113597
AA seq 98 aa
MAAMQWCGAMTRRIMMTQRTSAALNCSARYSSLSPACAAPAVSEMDLCGRGDKKTKKGKR
FKGSYGNSRGKKQKMIERIKDKLELPRSTPWPLPFKLI
NT seq 297 nt   +upstreamnt  +downstreamnt
atggcggcgatgcagtggtgcggcgcgatgacacgacggattatgatgacgcagcgaaca
tctgcagctctgaattgttcggcgaggtattcatcgttatctccggcgtgtgcagctccg
gcggtatcggaaatggatttgtgtgggagaggagataagaagacgaagaaagggaaaaga
ttcaaaggatcgtacgggaattcgagagggaagaaacagaagatgattgagagaatcaaa
gacaagcttgagcttcccaggtctactccttggcctcttcctttcaagctcatctga

DBGET integrated database retrieval system