KEGG   Arabidopsis thaliana (thale cress): AT2G22500
Entry
AT2G22500         CDS       T00041                                 

Gene name
UCP5
Definition
(RefSeq) uncoupling protein 5
  KO
K15104  solute carrier family 25 (mitochondrial oxoglutarate transporter), member 11
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
KEGG Orthology (KO) [BR:ath00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ath02000]
    AT2G22500 (UCP5)
Transporters [BR:ath02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   AT2G22500 (UCP5)
SSDB
Motif
Pfam: Mito_carr DUF2613
Other DBs
NCBI-GeneID: 816783
NCBI-ProteinID: NP_179836
MIPS: AT2G22500.1
TAIR: AT2G22500
UniProt: Q9SJY5 A0A178W292
Position
2
AA seq 313 aa
MGLKGFAEGGIASIVAGCSTHPLDLIKVRMQLQGESAPIQTNLRPALAFQTSTTVNAPPL
RVGVIGVGSRLIREEGMRALFSGVSATVLRQTLYSTTRMGLYDIIKGEWTDPETKTMPLM
KKIGAGAIAGAIGAAVGNPADVAMVRMQADGRLPLTDRRNYKSVLDAITQMIRGEGVTSL
WRGSSLTINRAMLVTSSQLASYDSVKETILEKGLLKDGLGTHVSASFAAGFVASVASNPV
DVIKTRVMNMKVVAGVAPPYKGAVDCALKTVKAEGIMSLYKGFIPTVSRQAPFTVVLFVT
LEQVKKLFKDYDF
NT seq 942 nt   +upstreamnt  +downstreamnt
atgggtctaaagggttttgctgaaggaggaatagcttcgattgttgcgggttgttcgacc
cacccgcttgatctaatcaaggtccgaatgcaacttcaaggcgaatcagctccgattcaa
accaatctccgaccagctcttgcttttcagacttcgaccaccgtcaacgcgcctcctcta
cgtgttggtgtaatcggagtcggatctcgtttaataagagaagaaggcatgcgtgctctg
ttttccggcgtctccgccaccgttcttcgtcaaactctgtattcaacgactcgtatgggt
ttatacgacatcatcaaaggagaatggaccgacccggaaacaaaaacgatgcctttaatg
aaaaaaatcggtgccggagccatcgccggagcaatcggagccgccgttgggaatcctgct
gacgtggcgatggtgaggatgcaagccgatggtcgtttaccgttgactgatagaagaaac
tacaaaagcgttttagacgcgatcacgcaaatgattcgcggtgaaggcgttacgtcgttg
tggagaggatcgtctttgacgataaacagagcaatgcttgtgacgtcatcgcagttggct
tcgtatgattctgttaaagagacgattttggagaaagggttgttgaaagatgggcttggg
actcatgtgtcggcgagtttcgcggcggggtttgttgcgagcgttgcgagtaatcctgtt
gatgtgattaagacgagagtgatgaatatgaaggtggtggctggagttgctccgccgtat
aaaggagcggttgattgtgctttgaaaacggtgaaagcggaagggattatgtctttgtat
aaaggttttatcccgacggtttcgagacaagcaccgttcacggtggttttgtttgttacg
cttgaacaagttaagaagttgttcaaggactatgacttttga

DBGET integrated database retrieval system