KEGG   Arabidopsis thaliana (thale cress): AT2G22610Help
Entry
AT2G22610         CDS       T00041                                 

Definition
(RefSeq) Di-glucose binding protein with Kinesin motor domain-containing protein
  KO
K10406  kinesin family member C2/C3
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
KEGG Orthology (KO) [BR:ath00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:ath04812]
    AT2G22610
Cytoskeleton proteins [BR:ath04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     AT2G22610
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Kinesin Microtub_bd Malectin MAD BRE1 DUF1664 MbeD_MobD Viral_P18
Motif
Other DBs
NCBI-GeneID: 816792
NCBI-ProteinID: NP_179846
MIPS: AT2G22610.1
TAIR: AT2G22610
Araport: AT2G22610
UniProt: F4IJK6
Position
2
AA seq 1083 aa AA seqDB search
MDDVQIDDTFPVDLNGVTSLCSPEIPSFDFVSDETEKLEIGDTSIDDCDDALGDSMVCDP
NSRLVPTGLTRTNRTDETIMFINAGGDDSKVLDSELNISRDDYFEGGDVLRTEESIVEAG
DFPFIYQSARVGNFCYQLNNLLPGEYLIDFHFAEIINTNGPKGIRVFNVYVQDEKATEFD
IFSVVGANRPLLLVDLRVMVMDDGLIRVRFEGINGSPVVCGICLRKAPQVSVPRTSQDFI
KCENCATEIEISPTRKRLMRAKAHDKYEKKIAELSERYEHKTNECHEAWMSLTSANEQLE
KVMMELNNKIYQARSLDQTVITQADCLKSITRKYENDKRHWATAIDSLQEKIEIMKREQS
QLSQEAHECVEGIPELYKMVGGVQALVSQCEDLKQKYSEEQAKRKELYNHIQETKGNIRV
FCRCRPLNTEETSTKSATIVDFDGAKDGELGVITGNNSKKSFKFDRVYTPKDGQVDVFAD
ASPMVVSVLDGYNVCIFAYGQTGTGKTFTMEGTPQNRGVNYRTVEQLFEVARERRETISY
NISVSVLEVYNEQIRDLLATSPGSKKLEIKQSSDGSHHVPGLVEANVENINEVWNVLQAG
SNARSVGSNNVNEHSSRSHCMLSIMVKAKNLMNGDCTKSKLWLVDLAGSERLAKTDVQGE
RLKEAQNINRSLSALGDVIYALATKSSHIPYRNSKLTHLLQDSLGGDSKTLMFVQISPSE
HDVSETLSSLNFATRVRGVELGPARKQVDTGEIQKLKAMVEKARQESRSKDESIKKMEEN
IQNLEGKNKGRDNSYRSLQEKNKDLQNQLDSVHNQSEKQYAQLQERLKSRDEICSNLQQK
VKELECKLRERHQSDSAANNQKVKDLENNLKESEGSSLVWQQKVKDYENKLKESEGNSLV
WQQKIKELEIKHKDEQSQEAVLLRQKIKELEMRLKEQEKHIQEMATTREFPEVANATPNE
VKTCFKEDNFGNENMESNTNILRTSNRLKTKRHDSLNLNEMTRKKRASRSGETENNGDDP
QMKEKRIRKSDPPKVFSRVVRPTRTASGSSSQVPVAQKRVIKREQQEVPVVKERDSKKKI
WSR
NT seq 3252 nt NT seq  +upstreamnt  +downstreamnt
atggatgatgttcagatcgatgatacttttccggtggatctaaatggggttacgtcactt
tgttcaccggagattcctagtttcgatttcgttagtgatgaaacagagaaattagagatc
ggagatacttccattgatgactgtgacgatgcattgggcgactccatggtgtgtgatccg
aattcaagactggttcctactggtctcacaagaactaatcgcacagatgagacaattatg
ttcataaatgctggaggagatgattcaaaggtattagattctgaattgaatatctccaga
gatgactatttcgaaggaggagatgtgttgagaacagaagagtctatagttgaagctgga
gactttccgttcatttatcagtcagcacgtgttgggaacttttgttaccagttaaacaat
cttcttccgggagagtacttgatcgatttccatttcgcggagattattaacaccaatgga
cctaaagggataagggttttcaacgtctatgttcaagatgagaaggcaactgagtttgat
atattctcggttgttggcgcaaataggccactcctgttggttgacttaagggtcatggtg
atggatgatggattgattagggtaaggtttgaaggaataaatggaagtccagtggtttgt
gggatttgtcttaggaaagcgccacaggtttcagttccaaggacatcacaagattttatt
aagtgtgagaattgtgctaccgaaatcgagatttctcctactcggaagagacttatgcga
gccaaagctcatgacaagtatgagaagaaaatagcagagctttctgaacgatatgaacat
aagacaaatgagtgccacgaagcatggatgtcactgacctctgccaatgagcaactagag
aaagtgatgatggaactcaacaataagatatatcaggcacgctctctagaccaaactgtg
ataacacaagctgattgtttgaagagtatcactagaaagtatgagaatgacaagagacat
tgggccacagcaattgattctctacaggagaaaatagagataatgaaaagggaacaatct
cagctatcacaggaagcacatgaatgcgttgaagggatccccgaactgtataaaatggtt
ggtggagttcaggcactcgtttcacagtgtgaagatctaaagcagaagtacagtgaagag
caagcaaaacgaaaggagctgtacaaccatatacaggagacgaaaggcaatattagggtc
ttttgtcgctgccgccctttgaatacggaggagacatcaaccaagtctgccacaattgtt
gactttgatggagcaaaagatggagagcttggtgttattacaggaaataattccaagaaa
agtttcaagtttgacagagtttatacaccgaaagatggtcaagttgatgtcttcgccgat
gcttctccgatggttgtttcagtcctagacggctacaatgtttgtatttttgcctacgga
caaacaggaacaggaaagacgtttacaatggaaggtactccgcagaacaggggtgtcaat
tatagaaccgtcgagcaattgtttgaagttgctagagaaaggagagagaccatttcatat
aacatatcggttagtgtccttgaggtctacaatgaacaaataagagacttgttggcaaca
tcaccagggtcaaagaagttggagataaaacaatcctctgatggctctcatcacgttcct
ggattagtagaagcaaatgtggaaaatataaatgaagtctggaatgtgcttcaagctggg
agcaacgcaagatcagttggatcaaataatgtgaacgagcatagcagccgctctcactgc
atgctctctataatggtgaaagcaaagaacctgatgaatggtgattgcacaaaaagcaag
ctttggcttgtagatttagctggaagtgagagattggcaaagacggatgtgcaaggtgag
cgtctgaaggaagcacaaaacatcaacaggtcactctcagctctgggggatgtgatttat
gctttggcaacaaagagtagtcatattccatacaggaactcaaaattaacacatttgctt
caagattcactaggaggtgattcaaagacattgatgtttgtgcaaatcagtccatctgag
catgatgtgagtgaaactctaagttcacttaactttgcaactcgtgtaagaggggttgaa
ttgggtcctgcaaggaagcaagttgataccggtgagatccagaagttgaaagcaatggtg
gagaaagcaagacaagaaagccgatctaaagatgaatccataaagaaaatggaggagaac
attcagaatctggaaggtaagaacaaaggaagagacaactcatacagaagtctccaggaa
aaaaacaaagaccttcaaaaccaacttgattcagtccacaaccaatcagaaaaacaatat
gcacagcttcaagagagactaaagagcagagatgagatttgtagcaatcttcaacaaaag
gtcaaggagctagagtgcaagctacgggagagacaccaatcagattctgcagctaacaac
cagaaggttaaggatcttgagaataatttgaaagaatctgaaggaagctcccttgtgtgg
caacagaaggttaaggattacgagaataagttgaaagagtctgaaggaaactctcttgtg
tggcaacagaagattaaagagttggagataaaacacaaagacgagcagagccaagaagca
gtgttactacgacaaaagatcaaagaacttgagatgaggctaaaggagcaagagaagcat
atacaggaaatggcaacaactagagaattccctgaagttgcaaacgctacgcctaatgaa
gtgaaaacttgcttcaaagaagataactttggcaatgagaatatggaatccaacaccaac
atcctgagaacatcaaaccgtctcaagactaaaagacacgattcattaaatctcaatgag
atgactagaaagaagagggcctcgagaagcggcgaaacagagaacaatggtgatgatcct
caaatgaaggagaaacggatcagaaaatcagacccaccaaaagttttctccagagtagtc
agaccaactagaacagcttctggttcatcaagccaagtccctgtggctcagaagagagtt
attaaaagagaacaacaagaagttccggtcgtgaaagagagagactccaagaagaagatt
tggtcaagataa

DBGET integrated database retrieval system