KEGG   Arabidopsis thaliana (thale cress): AT2G22990Help
Entry
AT2G22990         CDS       T00041                                 

Gene name
SNG1
Definition
(RefSeq) sinapoylglucose 1
  KO
K09757  serine carboxypeptidase-like 8 [EC:3.4.16.- 2.3.1.92]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00940  Phenylpropanoid biosynthesis
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    AT2G22990 (SNG1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ath01002]
    AT2G22990 (SNG1)
Enzymes [BR:ath01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.92  sinapoylglucose---malate O-sinapoyltransferase
     AT2G22990 (SNG1)
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.-  
     AT2G22990 (SNG1)
Peptidases and inhibitors [BR:ath01002]
 Serine peptidases
  Family S10
   AT2G22990 (SNG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_S10 UCR_hinge
Motif
Other DBs
NCBI-GeneID: 816830
NCBI-ProteinID: NP_850034
MIPS: AT2G22990.1
TAIR: AT2G22990
Araport: AT2G22990
UniProt: Q8RUW5 A0A178VQT7
Position
2
AA seq 433 aa AA seqDB search
MSLKIKFLLLLVLYHHVDSASIVKFLPGFEGPLPFELETGYIGIGEDENVQFFYYFIKSE
NNPKEDPLLIWLNGGPGCSCLGGIIFENGPVGLKFEVFNGSAPSLFSTTYSWTKMANIIF
LDQPVGSGFSYSKTPIDKTGDISEVKRTHEFLQKWLSRHPQYFSNPLYVVGDSYSGMIVP
ALVQEISQGNYICCEPPINLQGYMLGNPVTYMDFEQNFRIPYAYGMGLISDEIYEPMKRI
CNGNYYNVDPSNTQCLKLTEEYHKCTAKINIHHILTPDCDVTNVTSPDCYYYPYHLIECW
ANDESVREALHIEKGSKGKWARCNRTIPYNHDIVSSIPYHMNNSISGYRSLIYSGDHDIA
VPFLATQAWIRSLNYSPIHNWRPWMINNQIAGYTRAYSNKMTFATIKGGGHTAEYRPNET
FIMFQRWISGQPL
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgagtttgaaaataaagtttctgcttctgcttgtcttgtatcatcatgttgattctgcc
tctatcgtcaagtttcttcctggttttgaaggccctcttcctttcgaacttgaaaccggg
tacattggtattggtgaggacgagaatgtgcaatttttctactatttcatcaaatctgaa
aacaatccaaaagaagatcctcttcttatatggttaaatggaggacctggatgttcttgt
cttggtggtattatttttgagaacggaccggtgggtttgaagtttgaggtgttcaacgga
agtgctccttctttgttctctactacatattcatggacaaagatggcaaacattatattc
ttggatcagccagtaggatctggcttctcctactcaaaaactccaattgataaaactggt
gacataagtgaagtaaagaggacccatgagtttcttcaaaagtggctaagcaggcatcca
caatatttctccaaccctttatatgtagttggagattcttattccggtatgattgtcccg
gccctcgttcaagaaatctcacaaggaaattatatatgttgcgaacctcctataaatcta
cagggttatatgcttggaaaccctgtaacatatatggactttgaacaaaacttccgcatt
ccatatgcttatggtatgggattaatctccgacgaaatctatgagccaatgaagagaatc
tgcaacggaaattattacaatgtggatccatctaacacacaatgtttgaaacttactgaa
gaatatcataagtgcactgccaaaataaatatccatcacatattaacaccagattgcgat
gtaaccaatgtaacatctcctgattgttattattatccatatcatctcattgaatgttgg
gctaacgacgagagcgttcgcgaagctcttcatattgaaaagggtagtaaaggaaaatgg
gcgcgatgtaatcggactattccatacaatcacgacattgtaagcagcataccatatcac
atgaataacagcatcagtggataccgatctcttatttacagtggtgatcacgacatcgcg
gtcccttttcttgcaactcaagcctggataagatctctcaattactcccccattcataac
tggaggccatggatgataaacaatcaaatcgctggatacacgagagcttattccaataag
atgacatttgctactatcaaaggaggtggacacacggcagagtatagaccaaacgagacc
tttatcatgttccaaaggtggatcagtggccaacccctgtaa

DBGET integrated database retrieval system