KEGG   Arabidopsis thaliana (thale cress): AT2G24740
Entry
AT2G24740         CDS       T00041                                 

Gene name
SDG21
Definition
(RefSeq) SET domain group 21
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB
Motif
Pfam: SAD_SRA SET Pre-SET
Other DBs
NCBI-GeneID: 817010
NCBI-ProteinID: NP_180049
MIPS: AT2G24740.1
TAIR: AT2G24740
UniProt: Q9C5P0
Position
2
AA seq 755 aa
MVSTPPTLLMLFDDGDAGPSTGLVHREKSDAVNEEAHATSVPPHAPPQTLWLLDNFNIED
SYDRDAGPSTGPVHRERSDAVNEEAHATSIPPHAPPQTLWLLDNFNIEDSYDRDAGPSTS
PIDREASHEVNEDAHATSAPPHVMVSPLQNRRPFDQFNNQPYDASAGPSTGPGKRGRGRP
KGSKNGSRKPKKPKAYDNNSTDASAGPSSGLGKRRCGRPKGLKNRSRKPKKPKADDPNSK
MVISCPDFDSRITEAERESGNQEIVDSILMRFDAVRRRLCQLNYRKDKILTASTNCMNLG
VRTNMTRRIGPIPGVQVGDIFYYWCEMCLVGLHRNTAGGIDSLLAKESGVDGPAATSVVT
SGKYDNETEDLETLIYSGHGGKPCDQVLQRGNRALEASVRRRNEVRVIRGELYNNEKVYI
YDGLYLVSDCWQVTGKSGFKEYRFKLLRKPGQPPGYAIWKLVENLRNHELIDPRQGFILG
DLSFGEEGLRVPLVNEVDEEDKTIPDDFDYIRSQCYSGMTNDVNVDSQSLVQSYIHQNCT
CILKNCGQLPYHDNILVCRKPLIYECGGSCPTRMVETGLKLHLEVFKTSNCGWGLRSWDP
IRAGTFICEFTGVSKTKEEVEEDDDYLFDTSRIYHSFRWNYEPELLCEDACEQVSEDANL
PTQVLISAKEKGNVGRFMNHNCWPNVFWQPIEYDDNNGHIYVRIGLFAMKHIPPMTELTY
DYGISCVEKTGEDEVIYKGKKICLCGSVKCRGSFG
NT seq 2268 nt   +upstreamnt  +downstreamnt
atggtctcaacacctccaaccctattaatgctatttgatgatggagatgctggtcctagt
actggtttagtccaccgagaaaaatctgatgctgttaatgaagaagcccacgcaacatca
gtacctcctcatgcaccgccacaaaccctttggctattagataacttcaacattgaggac
tcttatgaccgagatgctggtcctagtactggtccagtccacagagaaagatcagatgct
gttaatgaagaagcccacgcaacatcaatacctcctcatgcaccgccacaaaccctttgg
ctattagataacttcaacattgaggactcttatgaccgagatgccggtcctagtactagt
ccaatagaccgagaagcatctcatgaagtcaatgaagacgcccacgcaacatcagcacct
cctcatgtaatggtctcaccactacaaaacagaagaccatttgatcaattcaacaaccaa
ccttatgatgcgagtgctggtcctagtactggtccaggaaagcgaggacgtggccgacca
aagggttcgaaaaatgggtcgagaaagccaaaaaagccaaaagcatatgacaacaactct
actgatgcgagtgctggtcctagttctggtctaggaaaacgaagatgtggccgaccaaag
ggtttaaaaaacaggtcgagaaagccaaagaagccaaaagcagatgatcctaatagcaaa
atggttatctcttgtccggattttgattcaaggataaccgaagcagagagagaaagcgga
aaccaggagatagttgattcgattttgatgcggtttgacgcggttagacggcggttatgc
caactaaactaccggaaagacaagatccttacagcgtcaactaattgcatgaatttgggg
gtccggacaaacatgacgaggagaattggacccattcccggagtacaagtaggtgatata
ttctattactggtgtgaaatgtgtttagtcgggcttcacagaaacacggctggaggcatt
gatagtctattggctaaagagagtggagtggatggtcctgctgctacgagtgtggtaaca
tcaggaaagtacgacaatgaaaccgaggatcttgaaacgttgatctatagcggacatggt
ggtaaaccatgtgatcaagttttacaaagaggaaaccgtgcactagaagcaagtgtaaga
agaaggaatgaagtaagagtcataagaggggagctctataataatgagaaggtatatatc
tatgatggactttatctggtctctgattgctggcaagtgacaggaaaatccggtttcaag
gagtataggttcaaactgctgaggaaaccaggccaacctcctggttatgcaatctggaaa
ttagttgaaaatttgaggaatcatgaattgattgatccaagacaaggttttatacttgga
gatctttcttttggagaagagggtttacgagttccgctcgttaatgaagtcgatgaagaa
gacaaaacgattcctgacgattttgactacattagatctcagtgttactcaggtatgacg
aatgatgttaatgttgatagtcaatcacttgttcagtcatacattcatcaaaactgcaca
tgcattctaaaaaactgtggtcagttaccataccatgacaacattttggtttgtcgtaaa
ccattgatttacgagtgtggtggatcttgtccaacccgaatggttgaaaccggtttgaag
ctccacttggaagtgtttaagacatcaaactgtggttggggtttacgttcttgggatcca
atccgagctggaacttttatctgcgagtttactggtgtgagcaagacgaaagaagaagta
gaagaagatgacgactacttgttcgatacatctcggatttatcatagcttcagatggaac
tatgaaccggagcttttgtgtgaagatgcttgcgaacaagtctctgaagatgctaatctt
ccaacgcaagtcttgataagcgccaaggagaaaggaaatgttggtcggttcatgaaccac
aactgttggcctaatgttttctggcagcctatagagtatgatgataacaacggtcacata
tatgttcgcattggactttttgcgatgaagcacattcctccaatgacagagttaacatat
gactatggaatttcttgtgtggagaagactggagaagacgaagtaatttataaaggaaag
aagatttgtctctgtggttcagtcaaatgtcgtggctcttttggctga

DBGET integrated database retrieval system