KEGG   Arabidopsis thaliana (thale cress): AT2G25680
Entry
AT2G25680         CDS       T00041                                 

Symbol
MOT1
Name
(RefSeq) molybdate transporter 1
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB
Motif
Pfam: MFS_MOT1 FAM209
Other DBs
NCBI-GeneID: 817109
NCBI-ProteinID: NP_180139
TAIR: AT2G25680
UniProt: Q9SL95
Position
2:complement(10933005..10934604)
AA seq 456 aa
MESQSQRGQHETPKRSRFTGMFHKLKTNLVFRSKLAEINGAMGDLGTYIPIVLALTLAKD
LDLGTTLIFTGIYNAITGAVYGVPMPVQPMKSIAAVAISSTAEDFGIPEIMAAGICTGGI
LFVLGISGLMQLVFNIIPLSVVRGIQLSQGLAFAMSAVKYIRKEQNFSKSKSVGDRPWLG
LDGLVLALVCVLFIVLVNGDGEEEEEEEEGDGSRGRGRWGSVRKVIANVPSALLIFLLGV
VLAFIRKPSIVHDIKFGPSKMKIVRISRKAWRNGFLKGTVPQLPLSVLNSVVAVCKLSYD
LFPEKEFSAASVSMTVGLMNMVGCWFGAMPTCHGAGGLAGQYKFGGRSGGCVALLGVAKL
VLGLVLGGSLVGILEKFPVGVLGALLLFAGVELAMAARDMNTKGDAFVMLMCTSVSLGSN
AAIGFVAGDLLYVVLWMRNYGRAKPSSLPPQSGEHA
NT seq 1371 nt   +upstreamnt  +downstreamnt
atggagtctcagtctcagagaggtcaacacgaaaccccgaaacgttctaggttcaccgga
atgttccataaactgaaaacgaatcttgttttccggtcgaagctagccgaaataaacggt
gcaatgggtgatcttggtacttacataccaatcgtcctcgctttaactctagccaaggat
ttggatttaggcacaacactgatattcaccggcatatacaacgcgataaccggagcagtt
tacggtgtccccatgccggttcaaccgatgaaatcgatagcagccgtggcgatttcgtct
accgcggaagatttcggtataccggagattatggctgccggaatatgtaccggagggatc
ttgttcgtgttggggatctctggtttgatgcagcttgtgttcaatataatccctttatcg
gttgttagagggattcagttgtcacaaggcttagcttttgccatgtctgcggttaagtat
ataaggaaagagcagaatttttcgaagtcaaagagtgttggtgataggccatggttaggg
cttgatggtttggttttggctttggtttgtgttctgttcatagttcttgtgaatggagat
ggtgaagaagaagaggaagaggaagaaggagatggttcgagaggaagaggaagatggggt
tcggtgaggaaggttatagctaacgtgccatctgctctgttgatattcttgttgggtgtt
gttttggcatttataaggaagccgagtattgtacatgacatcaagtttggaccgtcaaag
atgaagattgtgagaataagccgaaaagcatggagaaacgggtttttgaaagggacggtc
ccgcagttacctctttctgttcttaattctgttgtggctgtgtgtaagctgtcgtatgat
ctgttccccgagaaggagttctcggctgcatcggtttccatgactgttgggctgatgaat
atggtgggatgttggtttggagcaatgcctacttgtcatggagctggtggtttagccggg
cagtataagtttggtgggaggagtggtgggtgtgtggcactgttgggagtagctaaactg
gtgctagggttggtcttgggaggttcattggtgggtatattggagaagtttccggttggt
gtgctcggggcattgctactatttgcaggggtagagcttgcaatggcggctagagatatg
aatacaaagggagatgcatttgtaatgcttatgtgcacatcagtctctttgggatcaaat
gctgccataggctttgttgctggtgatcttttgtatgtggttttgtggatgcggaactac
gggcgagcgaagccgagcagccttcccccgcaatccggtgaacatgcttga

DBGET integrated database retrieval system