KEGG   Arabidopsis thaliana (thale cress): AT2G27040Help
Entry
AT2G27040         CDS       T00041                                 

Gene name
AGO4
Definition
(RefSeq) Argonaute family protein
  KO
K11593  eukaryotic translation initiation factor 2C
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
KEGG Orthology (KO) [BR:ath00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ath03019]
    AT2G27040 (AGO4)
   03036 Chromosome and associated proteins [BR:ath03036]
    AT2G27040 (AGO4)
Messenger RNA biogenesis [BR:ath03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     AT2G27040 (AGO4)
Chromosome and associated proteins [BR:ath03036]
 Eukaryotic type
  Gene silencing
   RISC (RNA-induced silencing complex)
    AT2G27040 (AGO4)
   RNA interference (RNAi) pathway
    RITS (RNA-induced transcriptional silencing) complex
     AT2G27040 (AGO4)
   microRNA pathway
    RISC loading complex
     AT2G27040 (AGO4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Piwi ArgoN PAZ ArgoL2 ArgoL1 ArgoMid
Motif
Other DBs
NCBI-GeneID: 817246
NCBI-ProteinID: NP_001189613
MIPS: AT2G27040.1
TAIR: AT2G27040
Araport: AT2G27040
UniProt: Q9ZVD5
Position
2
AA seq 924 aa AA seqDB search
MDSTNGNGADLESANGANGSGVTEALPPPPPVIPPNVEPVRVKTELAEKKGPVRVPMARK
GFGTRGQKIPLLTNHFKVDVANLQGHFFHYSVALFYDDGRPVEQKGVGRKILDKVHQTYH
SDLDGKEFAYDGEKTLFTYGALPSNKMDFSVVLEEVSATRANGNGSPNGNESPSDGDRKR
LRRPNRSKNFRVEISYAAKIPLQALANAMRGQESENSQEAIRVLDIILRQHAARQGCLLV
RQSFFHNDPTNCEPVGGNILGCRGFHSSFRTTQGGMSLNMDVTTTMIIKPGPVVDFLIAN
QNARDPYSIDWSKAKRTLKNLRVKVSPSGQEFKITGLSDKPCREQTFELKKRNPNENGEF
ETTEVTVADYFRDTRHIDLQYSADLPCINVGKPKRPTYIPLELCALVPLQRYTKALTTFQ
RSALVEKSRQKPQERMTVLSKALKVSNYDAEPLLRSCGISISSNFTQVEGRVLPAPKLKM
GCGSETFPRNGRWNFNNKEFVEPTKIQRWVVVNFSARCNVRQVVDDLIKIGGSKGIEIAS
PFQVFEEGNQFRRAPPMIRVENMFKDIQSKLPGVPQFILCVLPDKKNSDLYGPWKKKNLT
EFGIVTQCMAPTRQPNDQYLTNLLLKINAKLGGLNSMLSVERTPAFTVISKVPTIILGMD
VSHGSPGQSDVPSIAAVVSSREWPLISKYRASVRTQPSKAEMIESLVKKNGTEDDGIIKE
LLVDFYTSSNKRKPEHIIIFRDGVSESQFNQVLNIELDQIIEACKLLDANWNPKFLLLVA
QKNHHTKFFQPTSPENVPPGTIIDNKICHPKNNDFYLCAHAGMIGTTRPTHYHVLYDEIG
FSADELQELVHSLSYVYQRSTSAISVVAPICYAHLAAAQLGTFMKFEDQSETSSSHGGIT
APGPISVAQLPRLKDNVANSMFFC
NT seq 2775 nt NT seq  +upstreamnt  +downstreamnt
atggattcaacaaatggtaacggagctgatcttgaatcagcaaatggggcaaacgggagt
ggggttactgaggcattaccacctcctccaccagttatacctccaaatgtggaaccagtt
cgtgttaaaactgaacttgctgagaagaaggggccagttcgagttcctatggctcgaaaa
ggatttggaacaaggggccaaaagatccccttgttaacaaatcatttcaaagtcgatgtg
gctaatcttcagggtcatttcttccactacagtgtggctctattctatgatgatggtcgt
cctgttgaacaaaagggtgttggaagaaaaatccttgacaaggtgcatcagacttaccat
tctgatctggatggtaaagagtttgcttatgacggtgagaagacgttgtttacatatgga
gctttgcctagtaacaagatggatttttctgtggtgcttgaggaagtatctgctacaagg
gctaatggaaacggaagccccaatgggaatgaaagtccaagtgatggtgataggaaaaga
ctgcgtaggcctaaccggtccaaaaactttagagtggagatcagctatgcggccaaaatt
cctcttcaagctcttgctaatgcaatgcggggacaagaatcagagaattcccaggaggca
atacgggttcttgatatcatattgaggcaacatgctgctagacaaggttgcttgcttgtt
cgacagtcttttttccacaatgatccaaccaactgtgaaccagttggtggtaacatctta
ggatgtaggggatttcactccagtttcagaacaacgcagggtggcatgtcacttaatatg
gatgttacaaccaccatgatcatcaagcctggtccagtggttgatttcctaattgctaac
caaaatgctagggacccttattcgattgactggtctaaggctaaacgaacccttaagaac
ctaagggtaaaggtcagcccctcaggccaagaattcaagataaccggattgagtgacaag
ccttgcagggaacaaacgtttgaattgaagaaaaggaacccaaatgaaaatggagagttc
gaaactactgaagttacagttgctgactacttccgcgatacaaggcatattgatttgcaa
tattctgcggatttgccttgcatcaatgttgggaagccaaagcgacccacttacattcct
ctcgagctctgcgcgttggttccacttcagaggtacacaaaagcacttaccacgttccaa
agatctgcccttgttgagaaatccagacagaaaccccaagagaggatgactgttctgtcc
aaagctctgaaagttagcaactatgatgcggaaccactcctgcgatcctgtggcatttcg
atcagctccaactttactcaggtggagggtcgtgttctaccagctcccaagctgaaaatg
ggatgtggatctgaaacctttcccagaaatggtcgctggaacttcaacaacaaggaattt
gttgagcccaccaaaattcaacgatgggttgttgtcaatttctctgctcgctgtaatgta
cgtcaagttgttgatgatctgataaaaattggaggatcaaaaggaattgaaattgcttct
ccctttcaagtgtttgaggagggtaatcaattccgccgtgctcctcctatgattcgtgtt
gagaacatgtttaaggacatccaatcgaaactccctggtgtcccacaattcatactatgt
gtgctccctgacaaaaagaacagtgatctctatggtccatggaagaaaaaaaacttaact
gaatttggcattgttactcaatgcatggctccaacgcggcaacctaatgatcagtatctt
actaacttacttctgaagattaatgcaaagcttggaggcctgaactcaatgttaagtgta
gagcgtacacctgcgttcactgtgatttctaaggttccaaccattatccttgggatggat
gtttcacatggatctcctggacagtctgatgtcccgtccatcgctgctgtggtgagttct
agggagtggccactgatatccaaatatagagcatctgttcggacacagccttctaaggct
gagatgattgagtcccttgtcaagaaaaatggaactgaagacgatggcattatcaaggag
ttgctggtagatttctacaccagctcgaataagagaaaaccagagcatatcataattttc
agggatggtgtgagtgaatctcaattcaatcaggttctgaatattgaacttgatcagatc
atcgaggcttgcaagctcttagacgcaaattggaacccaaagttccttttgttggtggct
caaaagaatcatcataccaagttcttccagccaacgtctcctgaaaatgttcctccaggg
acaatcattgacaacaaaatatgtcacccaaagaacaatgatttctacctctgtgctcac
gctggaatgattggaactacccgcccaactcactaccacgtcctgtatgatgagattggt
ttttcagctgacgaacttcaggaacttgtccactcgctctcctatgtgtaccaaagaagc
accagtgccatttctgttgttgcgccgatctgctatgctcacttggcagctgctcagctt
gggacgttcatgaagtttgaagatcagtctgagacatcatcaagccatggtggtatcaca
gctccaggaccaatctctgttgcacagctcccaagactcaaagacaacgtcgccaactcc
atgttcttctgttaa

DBGET integrated database retrieval system