KEGG   Arabidopsis thaliana (thale cress): AT2G29970
Entry
AT2G29970         CDS       T00041                                 
Name
(RefSeq) Double Clp-N motif-containing P-loop nucleoside triphosphate hydrolases superfamily protein
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB
Motif
Pfam: AAA_2
Other DBs
NCBI-GeneID: 817547
NCBI-ProteinID: NP_565689
TAIR: AT2G29970
UniProt: O80875
Position
2:12776208..12780069
AA seq 1002 aa
MPTPVTTARQCLTEETARALDDAVSVARRRSHAQTTSLHAVSGLLTMPSSILREVCISRA
AHNTPYSSRLQFRALELCVGVSLDRLPSSKSTPTTTVEEDPPVSNSLMAAIKRSQATQRR
HPETYHLHQIHGNNNTETTSVLKVELKYFILSILDDPIVSRVFGEAGFRSTDIKLDVLHP
PVTSQFSSRFTSRSRIPPLFLCNLPESDSGRVRFGFPFGDLDENCRRIGEVLARKDKKNP
LLVGVCGVEALKTFTDSINRGKFGFLPLEISGLSVVSIKISEVLVDGSRIDIKFDDLGRL
KSGMVLNLGELKVLASDVFSVDVIEKFVLKLADLLKLHREKLWFIGSVSSNETYLKLIER
FPTIDKDWNLHLLPITSSSQGLYPKSSLMGSFVPFGGFFSSTSDFRIPSSSSMNQTLPRC
HLCNEKYEQEVTAFAKSGSMIDDQCSEKLPSWLRNVEHEHEKGNLGKVKDDPNVLASRIP
ALQKKWDDICQRIHQTPAFPKLSFQPVRPQFPLQLGSSSQTKMSLGSPTEKIVCTRTSES
FQGMVALPQNPPHQPGLSVKISKPKHTEDLSSSTTNSPLSFVTTDLGLGTIYASKNQEPS
TPVSVERRDFEVIKEKQLLSASRYCKDFKSLRELLSRKVGFQNEAVNAISEIVCGYRDES
RRRNNHVATTSNVWLALLGPDKAGKKKVALALAEVFCGGQDNFICVDFKSQDSLDDRFRG
KTVVDYIAGEVARRADSVVFIENVEKAEFPDQIRLSEAMRTGKLRDSHGREISMKNVIVV
ATISGSDKASDCHVLEEPVKYSEERVLNAKNWTLQIKLADTSNVNKNGPNKRRQEEAETE
VTELRALKSQRSFLDLNLPVDEIEANEDEAYTMSENTEAWLEDFVEQVDGKVTFKLIDFD
ELAKNIKRNILSLFHLSFGPETHLEIENDVILKILAALRWSSDEEKTFDQWLQTVLAPSF
AKARQKCVPAAPFSVKLVASRESPAEEETTGIQQFPARVEVI
NT seq 3009 nt   +upstreamnt  +downstreamnt
atgccgacaccagtaaccacggcgagacaatgtttaacggaagaaacagcgcgtgcatta
gacgacgcagtctccgtcgcgcgtcgtcgaagccacgcacaaacgacgtcacttcacgcc
gtttcaggtcttttaacaatgccttcatcgattctccgagaagtgtgtatctcacgcgcc
gcccacaacacaccgtactcttcacgtctccagtttcgcgcgcttgagctctgcgtcggc
gtttctctagacagattaccttcttcgaaatcaacaccaacgacgacggtggaagaagat
cctccggtctcaaactctctcatggcggcgatcaaaagatctcaagcgactcaacgacgt
catccagagacttatcatcttcatcaaatccatggaaacaacaacacggaaacgacgtcg
gttttgaaagttgagttgaagtattttatactatccattttagatgacccgattgtgagt
cgggtctttggtgaagccgggtttagaagcaccgacattaaactcgacgtgcttcatcct
ccggtgacgtctcaattctcttcacggttcacgtcaagatctcgtattcctcctctgttt
ttatgtaacttaccggaatctgactcgggtcgggttagattcgggtttccgtttggtgat
ctcgacgagaactgtagaagaatcggtgaagttttagcgaggaaagataagaagaatcca
ttactagttggtgtttgtggtgttgaagctcttaaaacgtttactgattctataaacaga
ggaaagtttggttttttacctttggagattagtgggttaagtgtagttagtataaagatt
agtgaagttttagttgatggatcaagaatagatataaagtttgatgatttagggagattg
aagtcagggatggttttgaaccttggagagttaaaggttttagctagtgatgttttctct
gttgatgtgattgagaagtttgtgttgaagctcgctgatttgttgaagcttcaccgtgag
aaactttggtttattggaagtgtttcgagtaatgagacgtatttgaagctgattgagagg
tttccaacgattgataaagattggaatcttcatcttcttcctattacatcttcaagtcaa
gggctttatccaaaatctagtttgatgggatcttttgttccatttggagggtttttctca
tccacatcggattttagaataccgtctagtagctcgatgaatcagactttacctcggtgt
catctttgtaacgagaagtatgagcaagaagtcaccgcctttgctaagtcggggtcgatg
atcgatgatcagtgttcggagaagttaccttcttggttacgaaatgtggagcatgaacac
gagaaaggaaatctcggaaaggttaaagatgatccaaacgtattagcctctcggattccc
gctctgcagaagaaatgggacgacatttgtcaaagaatccatcaaactccggcgtttcct
aaactcagttttcagcccgttagaccgcagttcccgcttcagcttggttcttctagccag
accaagatgagtcttggaagcccaactgagaaaattgtttgcactaggacgtctgaaagc
tttcaagggatggtggctctaccgcagaatccgccacaccaacctggtttatcagtcaaa
atctcaaagccaaaacatactgaggatctctcaagttcaacaacgaactcgcctttgagc
tttgttacaacagatttagggttgggaacaatctacgcatcgaagaaccaagaaccaagc
acaccagtatcagttgaaaggagagactttgaggtgatcaaagagaaacaattgttgtca
gcttcgagatactgcaaagatttcaagtctctcagggaactactctctcgaaaagtcggt
tttcagaacgaagctgtgaatgcgattagcgaaattgtttgtggatacagagatgagtcc
aggagaagaaacaaccacgtagcaaccacaagtaatgtttggcttgctcttcttggacct
gataaagccgggaagaagaaagtagcattagctcttgctgaagtcttctgtggtggacaa
gacaacttcatctgtgtggatttcaagtcacaagacagtcttgacgatagattcagaggg
aaaacagttgttgattacattgctggcgaagtggcgagacgtgcggattctgttgttttc
atcgaaaacgtggaaaaggccgagttccctgatcagatcagattgtctgaggctatgaga
actggaaaactccgtgactcgcatgggagagagatcagtatgaaaaatgttatagttgtt
gctactatttctggaagtgataaagccagtgattgtcatgttcttgaagaaccagtcaaa
tactccgaggaaagagttctcaatgccaaaaactggacacttcagataaaactagcagac
acttcaaatgttaacaagaatggtcccaataagagaagacaggaggaggcagaaacagag
gtgacagagcttcgagcccttaagtctcagcgttcgtttcttgatctaaatcttcctgtg
gatgagattgaagcaaacgaagacgaagcgtatacaatgtcggagaacacagaagcttgg
cttgaggattttgtggaacaagtagatgggaaagtgacgttcaagcttattgactttgat
gagttagcaaaaaacataaaaaggaatattctttcgctatttcatctgtcttttggacct
gaaacacatctagagatcgaaaacgatgtgatccttaagattcttgctgctttaagatgg
tcatcagatgaagagaaaacatttgatcagtggctgcaaactgttcttgctccaagcttt
gctaaagcgagacaaaagtgtgttcccgctgctcctttttctgtgaaacttgttgcctct
agagagtctccggctgaagaggagactacagggatacaacagtttccggcgagagtcgaa
gtgatctga

DBGET integrated database retrieval system