KEGG   Arabidopsis thaliana (thale cress): AT2G30100
Entry
AT2G30100         CDS       T00041                                 
Name
(RefSeq) pentatricopeptide (PPR) repeat-containing protein
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB
Motif
Pfam: PPR_2 PPR DUF58
Other DBs
NCBI-GeneID: 817561
NCBI-ProteinID: NP_180571
TAIR: AT2G30100
UniProt: Q0WNN7 A0A178VX94
Position
2:12847518..12849708
AA seq 503 aa
MAYAHVFASLTISTISLRRFLPRLHRNHSVKPNSRIICNLKLNYSAGKFREMGLSRSVEL
DQFITSEEEEGEAEEIGEGFFEAIEELERMTREPSDILEEMNHRLSSRELQLMLVYFAQE
GRDSWCTLEVFEWLKKENRVDEEIMELMVSIMCGWVKKLIEDECNAHQVFDLLIEMDCVG
LKPGFSMMDKVIALYCEMGKKESAVLFVKEVLRRRDGFGYSVVGGGGSEGRKGGPVGYLA
WKFMVDGDYRKAVDMVMELRLSGLKPEAYSYLIAMTAIVKELNSLGKTLRELKRFARAGF
VAEIDDHDRVLIEKYQSETLSRGLQLATWAVEEGQENDSIIGVVHERLLAMYICAGRGPE
AEKQLWKMKLAGREPEADLHDIVMAICASQKEVNAVSRLLTRVEFMGSQRKKKTLSWLLR
GYVKGGHFEEAAETLVSMIDSGLHPEYIDRVAVMQGMTRKIQRPRDVEAYMSLCKRLFDA
GLVGPCLVYMYIDKYKLWIVKMM
NT seq 1512 nt   +upstreamnt  +downstreamnt
atggcttatgctcatgttttcgcttcgttgactatctcgacgatttctctccgacgattc
ctcccccgacttcatcgaaaccacagcgtaaaacccaattcccgaatcatatgcaatctg
aaactaaactactctgctggaaaatttcgcgagatgggactatcacgttccgtggagcta
gaccaattcatcacaagcgaggaggaagaaggagaagcagaggagataggagaaggattt
ttcgaagcgattgaggaactagagaggatgactagagaaccatcagatatactcgaagag
atgaatcatcgattatcttctagagaattgcaattgatgcttgtttacttcgcacaagaa
ggtagagattcatggtgtactttagaagtgtttgaatggttgaaaaaggagaatagagtt
gatgaagagataatggagttaatggtttcgattatgtgtggttgggttaagaaattgatt
gaagatgaatgtaatgcacaccaagtgttcgacttattgattgagatggattgtgttggt
ttaaaacctggttttagtatgatggacaaagttattgctttgtattgtgagatggggaag
aaagaaagtgcggttttgtttgtcaaggaggttttaagaaggagagatggttttggttat
agtgttgttggtggtggtggttctgaaggtagaaaaggtggacctgttgggtatcttgct
tggaaatttatggttgatggagattataggaaggcagttgatatggttatggagttaaga
ctttcagggctgaaaccagaagcgtacagctatcttattgcgatgacagctatagtgaaa
gagctgaatagtcttggaaagacattacgcgagttgaaacgctttgcacgggctggtttt
gttgctgagattgatgatcacgatagggtactcattgagaagtatcaatcagaaacatta
tctcgtggactgcagttagcaacttgggcggttgaggaaggccaagaaaatgattccatt
attggggtggtccatgagaggctactcgctatgtatatatgtgcgggacgtggaccagaa
gcagagaaacagctctggaagatgaaacttgcagggagagaacctgaagctgacctccac
gacattgttatggcgatctgcgcttcacagaaagaggttaatgcagtttctcggctactg
acacgagttgagttcatgggatctcagagaaagaagaagactctgtcatggttgctcaga
gggtatgtgaaaggagggcacttcgaagaggctgcagagacattggtatcgatgatcgac
tctgggttgcatccggagtatattgatcgagtggctgtgatgcaaggaatgacaaggaag
atccaacggccgagagatgttgaagcatatatgagtctgtgcaagaggctctttgacgct
ggtttggtagggccttgtcttgtgtatatgtacatagataaatataagttgtggatagtg
aagatgatgtga

DBGET integrated database retrieval system