KEGG   Arabidopsis thaliana (thale cress): AT2G30360
Entry
AT2G30360         CDS       T00041                                 
Symbol
SIP4
Name
(RefSeq) SOS3-interacting protein 4
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr NAF ABC1 Kinase-like Kdo APH Haspin_kinase
Other DBs
NCBI-GeneID: 817586
NCBI-ProteinID: NP_180595
TAIR: AT2G30360
UniProt: O22932 A0A5S9X2L0
Position
2:complement(12936968..12938834)
AA seq 435 aa
MPEIEIAAGSGDNNDALFGKYELGKLLGCGAFAKVFHARDRRTGQSVAVKILNKKKLLTN
PALANNIKREISIMRRLSHPNIVKLHEVMATKSKIFFAMEFVKGGELFNKISKHGRLSED
LSRRYFQQLISAVGYCHARGVYHRDLKPENLLIDENGNLKVSDFGLSALTDQIRPDGLLH
TLCGTPAYVAPEILSKKGYEGAKVDVWSCGIVLFVLVAGYLPFNDPNVMNMYKKIYKGEY
RFPRWMSPDLKRFVSRLLDINPETRITIDEILKDPWFVRGGFKQIKFHDDEIEDQKVESS
LEAVKSLNAFDLISYSSGLDLSGLFAGCSNSSGESERFLSEKSPEMLAEEVEGFAREENL
RMKKKKEEEYGFEMEGQNGKFGIGICISRLNDLLVVVEARRRGGDGDCYKEMWNGKLRVQ
LIRVCDQTSSTNAAI
NT seq 1308 nt   +upstreamnt  +downstreamnt
atgccagagatcgagattgccgccggcagcggcgacaacaacgacgccttattcggtaaa
tatgagctcggaaagcttctcggatgcggcgcattcgccaaagtcttccacgcacgtgat
cgtcgtaccggccaaagcgtcgccgtgaaaatcctcaacaagaaaaaactcctcacaaat
ccagctctagccaacaacatcaaacgcgagatctcaatcatgagaagattatctcatcca
aacatcgtcaagctccacgaagtaatggcgacaaaatcaaagatcttcttcgcaatggag
tttgttaaaggaggagaactattcaacaaaatctcaaaacatggacgtcttagcgaagat
ttaagccggagatatttccagcaactgatctccgccgttggttattgccacgctcgcggt
gtttaccaccgcgatctcaaaccagagaatctattaatagacgaaaacggaaacttaaaa
gtttccgatttcggtctaagcgcgttaacggatcagatccgacccgatgggttgttacat
accttgtgtggtactccggcgtacgttgcgccggagattctatctaaaaaaggatatgaa
ggtgctaaagttgatgtatggtcttgtggaatcgtcttgttcgttctcgtcgccggttat
ttaccgtttaacgatccgaatgtgatgaatatgtataagaagatttataaaggagagtat
cgttttcctcgttggatgtctccagatctgaaacgattcgtttctcgtcttttagatatt
aatcctgagactagaatcaccattgatgagattttgaaagatccttggtttgttagagga
ggttttaaacagatcaagttccacgatgacgagatcgaagatcagaaagtggaatcgtca
ctagaagctgtgaagagtttaaacgcgtttgatttgatttcttactcgtcgggattggat
ttgtcgggattgtttgctggttgtagtaattcgagtggtgaatcggagaggtttttatcg
gaaaagtcgccggagatgttggcggaggaagtggaggggtttgcgagagaggagaatctg
aggatgaagaagaagaaggaggaagagtatgggtttgagatggaggggcaaaatgggaaa
tttggtatcgggatttgtatttcgcggttgaatgatttgcttgtggtggtggaggcacgg
cggagaggtggtgatggtgattgttataaggagatgtggaatggtaaactcagggttcaa
cttattcgcgtttgcgatcagacgtcgtcaacaaacgcggctatttaa

DBGET integrated database retrieval system