KEGG   Arabidopsis thaliana (thale cress): AT2G31170
Entry
AT2G31170         CDS       T00041                                 
Symbol
SYCO_ARATH
Name
(RefSeq) Cysteinyl-tRNA synthetase, class Ia family protein
  KO
K01883  cysteinyl-tRNA synthetase [EC:6.1.1.16]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:ath00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    AT2G31170 (SYCO_ARATH)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ath01007]
    AT2G31170 (SYCO_ARATH)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ath03016]
    AT2G31170 (SYCO_ARATH)
Enzymes [BR:ath01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.16  cysteine---tRNA ligase
     AT2G31170 (SYCO_ARATH)
Amino acid related enzymes [BR:ath01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   AT2G31170 (SYCO_ARATH)
Transfer RNA biogenesis [BR:ath03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    AT2G31170 (SYCO_ARATH)
 Prokaryotic type
    AT2G31170 (SYCO_ARATH)
SSDB
Motif
Pfam: tRNA-synt_1e tRNA-synt_1g tRNA-synt_1 DALR_2 tRNA-synt_1f GHMP_kinases_C HisKA
Other DBs
NCBI-GeneID: 817673
NCBI-ProteinID: NP_565717
TAIR: AT2G31170
UniProt: F4IPY2 A0A178VWT1
Position
2:complement(13282355..13285678)
AA seq 563 aa
MASSVLNLFKSCRPFTPIRFSSLPKSQFRIQFPLRPGKETQLRRCFTTLSSLTDGGAPIS
GGKELWLHNTMSRKKELFKPKVEGKVGMYVCGVTAYDLSHIGHARVYVTFDVLLRYLKHL
GYEVSYVRNFTDVDDKIIARAKELEEDPISLSRRFCEEFNRDMEQLQCLDPSVQPRVSDH
IPQIIDLIKQILDNGYAYKVDGDIYFSVDKFPTYGKLSGRKLEDNRAGERVAVDTRKKHP
ADFALWKAAKEGEPFWESPWGRGRPGWHIECSAMSAAYLGYSFDIHGGGMDLVFPHHENE
IAQSCAACDSSNISYWIHNGFVTVDSEKMSKSLGNFFTIRQVIDLYHPLALRLFLMGTHY
RSPINYSDFLLESASERIFYIYQTLHDCESALGEKDSTFENGSVPSDTLTSINTFRTEFV
ASMSDDLLTPVTLAAMSEPLKTINDLIHTRKGKKQARREESLKALETTIRDVLTILGLMP
TSYSEVLEQLKEKALKRAGLKEEDVLQRVQERTDARKNKEYERSDAIRKDLAKVGIALMD
SPEGTTWRPAIPLALQEPVTTTP
NT seq 1692 nt   +upstreamnt  +downstreamnt
atggcttcttctgtccttaatctcttcaaatcatgtagacccttcactccaatacgcttc
tcttctcttcccaagtctcaattcagaatccaatttcccctcagacccggaaaagaaact
caactacgtcgctgtttcacgactctgtcatcattaacggacggtggagcaccaatttcc
ggtgggaaggagctgtggctgcacaacacgatgagccggaagaaggagctgtttaagcct
aaggtcgaaggtaaagttggaatgtacgtttgcggtgtcactgcttacgatctcagtcac
attggacacgcacgagtctacgtcactttcgatgtactcttgaggtaccttaagcatcta
ggatatgaagtgtcttacgttcgaaatttcacggatgtggatgacaagattattgccaga
gcgaaagaattagaggaagatccaatcagtttgagcagacgtttctgtgaggaatttaat
cgagatatggaacagcttcaatgtttagatccgtctgtccaaccacgagtttcagatcat
atacctcaaatcatcgacctgatcaagcagattcttgataatggctatgcctacaaagtt
gatggagacatttacttctcagtcgacaaatttccaacatatggaaaattgtctgggcga
aaattagaagataaccgtgcaggtgagagagtcgcagttgacacgaggaagaaacatccc
gcagattttgctctgtggaaagctgcaaaagaaggggaacccttttgggagagtccgtgg
ggaagaggaaggcccggttggcacatagagtgcagtgcgatgagcgcggcttatctcggt
tatagttttgacatacatggtggcggaatggatcttgtgttccctcaccatgaaaatgaa
attgctcagagttgtgctgcatgtgatagcagcaacattagctattggatccataatggt
tttgttactgttgactccgagaagatgtcaaaatccttggggaatttcttcactatcaga
caggttatagacctttatcatcctcttgctctgagacttttcctaatgggaactcattat
cggtctcctatcaattactccgatttcctcctcgagagtgcttcggagcgcattttttat
atttatcagacgttacacgactgtgaaagcgctttaggcgagaaagattcgacatttgag
aatggttctgttccttcagacactttgacaagcatcaacacattccgtactgaatttgtc
gcctcgatgtctgatgatcttctcacacctgtaactctggctgcaatgtcagaaccactg
aaaactatcaacgatctcattcacacccgaaaggggaaaaaacaagcaagaagagaagag
tcacttaaggctctagagacaacaatcagagatgttcttactatcttagggcttatgccc
acaagttactcagaggttctcgagcagctaaaagagaaggcactaaagcgagctggacta
aaagaggaagatgtgttgcagagagtgcaagagagaacagacgcaaggaagaataaagaa
tacgaaagatctgatgcaattaggaaagatttggcaaaagttgggatcgctttgatggat
agtcctgagggaacaacttggagaccagccattcctcttgcacttcaagaacctgtaact
actacaccttga

DBGET integrated database retrieval system