KEGG   Arabidopsis thaliana (thale cress): AT2G31810Help
Entry
AT2G31810         CDS       T00041                                 

Definition
(RefSeq) ACT domain-containing small subunit of acetolactate synthase protein
  KO
K01653  acetolactate synthase I/III small subunit [EC:2.2.1.6]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00290  Valine, leucine and isoleucine biosynthesis
ath00650  Butanoate metabolism
ath00660  C5-Branched dibasic acid metabolism
ath00770  Pantothenate and CoA biosynthesis
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
ath01210  2-Oxocarboxylic acid metabolism
ath01230  Biosynthesis of amino acids
Module
ath_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
ath_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    AT2G31810
   00660 C5-Branched dibasic acid metabolism
    AT2G31810
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    AT2G31810
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    AT2G31810
Enzymes [BR:ath01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.6  acetolactate synthase
     AT2G31810
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ALS_ss_C ACT_5 ACT ACT_4 Serine_rich DUF4423
Motif
Other DBs
NCBI-GeneID: 817738
NCBI-ProteinID: NP_850172
MIPS: AT2G31810.1
TAIR: AT2G31810
Araport: AT2G31810
UniProt: Q93YZ7 A0A178VQ69
Position
2
AA seq 491 aa AA seqDB search
MAAISVSSSPSIRCLRSACSDSSPALVSSTRVSFPAKISYLSGISSHRGDEMGKRMEGFV
RSVDGKISDASFSEASSATPKSKVRKHTISVFVGDESGMINRIAGVFARRGYNIESLAVG
LNRDKALFTIVVCGTERVLQQVIEQLQKLVNVLKVEDISSEPQVERELMLVKVNAHPESR
AEIMWLVDTFRARVVDIAEHALTIEVTGDPGKMIAVERNLKKFQIREIVRTGKIALRREK
MGATAPFWRFSAASYPDLKEQAPVSVLRSSKKGAIVPQKETSAGGDVYPVEPFFDPKVHR
ILDAHWGLLTDEDTSGLRSHTLSLLVNDIPGVLNIVTGVFARRGYNIQSLAVGHAETKGI
SRITTVIPATDESVSKLVQQLYKLVDVHEVHDLTHLPFSERELMLIKIAVNAAARRDVLD
IASIFRAKAVDVSDHTITLQLTGDLDKMVALQRLLEPYGICEVARTGRVALARESGVDSK
YLRGYSFPLTG
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atggcggccatttctgtaagttcttcaccatctattcgctgcttgagatcggcatgttcc
gattcttctcctgctcttgtatcctcgacgcgtgtatcgttcccggcgaagatttcatat
ctctccggtatatcttcgcaccgtggcgatgaaatgggtaagagaatggaaggattcgtt
agaagcgtcgatgggaagatctctgatgcgtctttctccgaagcttcatctgcgactcca
aaatcgaaggtgaggaagcacacaatttcagtatttgttggagacgaaagcggaatgatt
aataggattgcaggagtgtttgcaaggagaggatacaatattgagagtcttgctgttggt
ctgaacagagacaaggctctattcaccatagttgtctgtggaactgaaagggtacttcag
caggtcatcgagcaactccagaagctcgttaatgttctaaaggttgaagatatctcaagt
gagccgcaagtggagcgtgagctgatgcttgtaaaagtgaatgcacatccagaatccagg
gcagagatcatgtggctagttgacacattcagagcaagagttgtagatatagcggaacat
gcattgactatcgaggtaactggagatcctggaaaaatgattgctgtagaaagaaatttg
aaaaagtttcagatcagagagattgtaaggacaggaaagatagcactgagaagggaaaag
atgggtgcaactgctccattttggcgattttcagcagcatcctatccagatctcaaggag
caagcgcctgttagtgttcttcgaagtagcaaaaaaggagccattgtccctcaaaaggaa
acatcagcagggggagatgtttatcccgttgagccattttttgaccccaaggtacatcgt
attctcgacgctcactggggacttctcactgacgaagatacgagtggactacggtcgcat
actctatcattgcttgtaaatgatattccaggagttcttaatattgtgactggtgttttc
gctcgaaggggatacaatatccagagcttggccgtaggacatgctgaaaccaagggcatt
tcacgcattacaacagttatacctgcaacagatgaatcggtcagcaaattggtgcagcaa
ctttacaaactcgtagatgtgcatgaggtccatgatcttactcatttgccattttctgaa
agagaactgatgctgattaagattgccgtgaacgctgctgctagaagagatgtcctggac
attgctagtattttcagggctaaagctgttgacgtatctgatcacacaattactttgcag
cttactggggatctagacaagatggttgcactgcaaaggttattggagccctatggtata
tgtgaggttgcaagaaccggtcgtgtggcattggctcgtgaatcgggagtggactccaag
taccttcgtggatactcctttcctttaacaggctaa

DBGET integrated database retrieval system