KEGG   Arabidopsis thaliana (thale cress): AT2G33750
Entry
AT2G33750         CDS       T00041                                 
Symbol
PUP2
Name
(RefSeq) purine permease 2
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB
Motif
Pfam: PUNUT EamA Nuc_sug_transp
Other DBs
NCBI-GeneID: 817941
NCBI-ProteinID: NP_180931
TAIR: AT2G33750
UniProt: Q94GB1
Position
2:complement(14271674..14273457)
AA seq 358 aa
MKMKTVLVIINCIFLAIGNCGGPLMMRLYFQNGGERIWFPSFLQTVGCPLIFFPLLLSFL
RRRRCLEEQETTPFFLMKPPLFIAAIVVGLLVGFDNYLYSYGLAYIPVSTASLIISAQLG
FTALFAFFMVKQKFTPFTINAIVLLTGGAVVLALNSDSDKLANETHKEYVVGFIMTLGAA
LLYGFILPLVELSYKKSGQRITYTLALEFQMVLCFAATCVCLVGMLAAGDFKVKHALFIF
KNRVIAGEARDFKLGESLYYVVIVFTAIIWQAFFVGAIGLIFCASSLVSGIMVSALLPVT
VILAVICFQEKFQAGKGVALALSLWGSVSYFYGQVKSEEKTKAQDTQLSQLPVTDYVA
NT seq 1077 nt   +upstreamnt  +downstreamnt
atgaagatgaagacagttcttgtaatcataaactgtatattcttggccattggaaactgt
ggaggccctctaatgatgcgtctctacttccaaaatggtggcgaaaggatctggtttcca
agcttccttcaaaccgttggttgtccactcattttcttccctcttctcttatctttcctc
cgccgtcgtcgttgccttgaagaacaagaaacgactccatttttcctcatgaaacctcct
ctctttatcgccgctatcgttgttggtttgctcgtgggatttgacaattacctctactct
tacgggttagcttatatccctgtttctactgcgtctttgatcatctccgcgcaattaggc
ttcactgctctctttgcattttttatggtgaagcaaaagttcacacctttcactataaac
gctatcgttttgctcactggtggtgccgtagtccttgcccttaactctgatagtgacaag
cttgcaaacgagacacacaaggaatatgttgttgggttcatcatgactcttggtgcagct
cttctctatgggtttatattgccacttgtcgagctttcttacaagaaatctggtcagcga
atcacgtatacgctcgcgctcgagttccagatggtcttatgctttgctgccacttgtgtc
tgcctcgtggggatgctagccgctggcgatttcaaggtaaaacatgctttgtttattttc
aagaatagggtgatagcaggagaagcaagagattttaagcttggagagtctttgtactat
gtggtgattgtgttcacggccataatctggcaagcattttttgtgggagctattgggttg
atcttctgtgcatcgtctctggtctctggaattatggtcagtgctctgcttccggtgacg
gtgatcttggccgtcatttgcttccaggagaagtttcaggcggggaaaggtgtcgctttg
gctctctccctctggggatcagtctcttatttctatggacaggttaaatccgaggagaag
actaaggctcaggatacacaactgtctcagcttccagttactgattatgtagcttaa

DBGET integrated database retrieval system