KEGG   Arabidopsis thaliana (thale cress): AT2G33820Help
Entry
AT2G33820         CDS       T00041                                 

Gene name
MBAC1
Definition
(RefSeq) Mitochondrial substrate carrier family protein
  KO
K15109  solute carrier family 25 (mitochondrial carnitine/acylcarnitine transporter), member 20/29
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
KEGG Orthology (KO) [BR:ath00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ath02000]
    AT2G33820 (MBAC1)
Transporters [BR:ath02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   AT2G33820 (MBAC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mito_carr Serine_protease
Motif
Other DBs
NCBI-GeneID: 817949
NCBI-ProteinID: NP_180938
MIPS: AT2G33820.1
TAIR: AT2G33820
Araport: AT2G33820
UniProt: Q84UC7 A0A178VWG0
Position
2
AA seq 311 aa AA seqDB search
MGESKTTTGEGFGFYKEYVAGMMAGLATVAVGHPFDTVKVKLQKHNTDVQGLRYKNGLHC
ASRILQTEGVKGLYRGATSSFMGMAFESSLMFGIYSQAKLFLRGTLPDDGPRPEIIVPSA
MFGGAIISFVLCPTELVKCRMQIQGTDSLVPNFRRYNSPLDCAVQTVKNDGVTGIFRGGS
ATLLRECTGNAVFFTVYEYLRYHIHSRLEDSKLKDGYLVDMGIGVLTGGLGGIACWSAVL
PFDVAKTIIQTSSEKATERNPFKVLSSIHKRAGLKGCYAGLGPTIVRAFPANAAAIVAWE
FSMKMLGIKRD
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgggagagagtaagacgacgacaggagagggcttcgggttttacaaggaatatgtcgcc
ggaatgatggctggtctcgccactgtcgccgtcggccaccctttcgacaccgtcaaggtg
aaacttcagaaacataatacagatgtgcaagggctcagatacaaaaatgggctgcattgt
gcttcgaggatcttgcaaactgaaggagtcaaaggactttataggggagcaacatcgtcg
tttatgggaatggcttttgaaagttcattgatgtttggcatatactcccaggctaagctg
ttcttgcggggaactttgccagatgatgggccacgaccagagataattgttccgtctgct
atgtttggtggagctatcattagttttgtgttatgtccaacagagctagtaaagtgtaga
atgcagatccaaggaacggattctctggttcctaacttccgtagatacaacagtcctctt
gattgtgccgttcagaccgttaaaaatgatggggtaacaggtatctttcgtggtggttcg
gcaaccttattaagagaatgtacgggaaatgctgtcttttttactgtctatgagtactta
cggtatcatatccactcgagattggaggattctaagctgaaagatggttacttggttgac
atggggataggagttctcactggtggtcttggaggcatagcttgctggtcagctgttttg
ccttttgatgtagcaaaaaccataatccagacctcttcagagaaagctacagagagaaat
ccttttaaagtgttgagctcgattcacaagagggcaggactcaagggatgctatgcaggt
ttgggtccaaccattgtgagagcattccctgctaatgcagcagcaattgttgcttgggag
ttctcaatgaaaatgttgggaatcaaacgtgactag

DBGET integrated database retrieval system