KEGG   Arabidopsis thaliana (thale cress): AT2G34660
Entry
AT2G34660         CDS       T00041                                 

Gene name
ABCC2
Definition
(RefSeq) multidrug resistance-associated protein 2
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB
Motif
Pfam: ABC_membrane ABC_tran SMC_N MMR_HSR1 Dynamin_N RsgA_GTPase AAA_16 T2SSE AAA_29 DUF87 AAA_23 TrwB_AAD_bind AAA_21
Other DBs
NCBI-GeneID: 818031
NCBI-ProteinID: NP_001189675
MIPS: AT2G34660.1
TAIR: AT2G34660
UniProt: Q42093
Position
2
AA seq 1623 aa
MGFEFIEWYCKPVPNGVWTKQVANAFGAYTPCATDSFVLGISQLVLLVLCLYRIWLALKD
HKVERFCLRSRLYNYFLALLAAYATAEPLFRLIMGISVLDFDGPGLPPFEAFGLGVKAFA
WGAVMVMILMETKIYIRELRWYVRFAVIYALVGDMVLLNLVLSVKEYYSSYVLYLYTSEV
GAQVLFGILLFMHLPNLDTYPGYMPVRSETVDDYEYEEISDGQQICPEKHANIFDKIFFS
WMNPLMTLGSKRPLTEKDVWYLDTWDQTETLFTSFQHSWDKELQKPQPWLLRALNNSLGG
RFWWGGFWKIGNDCSQFVGPLLLNQLLKSMQEDAPAWMGYIYAFSIFVGVVFGVLCEAQY
FQNVMRVGYRLRSALIAAVFRKSLRLTNEGRRKFQTGKITNLMTTDAESLQQICQSLHTM
WSAPFRIIIALILLYQQLGVASLIGALLLVLMFPLQTVIISKMQKLTKEGLQRTDKRIGL
MNEVLAAMDTVKCYAWENSFQSKVQTVRDDELSWFRKSQLLGALNMFILNSIPVLVTIVS
FGVFTLLGGDLTPARAFTSLSLFAVLRFPLFMLPNIITQVVNANVSLKRLEEVLATEERI
LLPNPPIEPGEPAISIRNGYFSWDSKGDRPTLSNINLDVPLGSLVAVVGSTGEGKTSLIS
AILGELPATSDAIVTLRGSVAYVPQVSWIFNATVRDNILFGSPFDREKYERAIDVTSLKH
DLELLPGGDLTEIGERGVNISGGQKQRVSMARAVYSNSDVYIFDDPLSALDAHVGQQVFE
KCIKRELGQKTRVLVTNQLHFLSQVDRIVLVHEGTVKEEGTYEELSSNGPLFQRLMENAG
KVEEYSEENGEAEADQTAEQPVANGNTNGLQMDGSDDKKSKEGNKKGGKSVLIKQEERET
GVVSWRVLKRYQDALGGAWVVMMLLLCYVLTEVFRVTSSTWLSEWTDAGTPKSHGPLFYN
LIYALLSFGQVLVTLTNSYWLIMSSLYAAKKLHDNMLHSILRAPMSFFHTNPLGRIINRF
AKDLGDIDRTVAVFVNMFMGQVSQLLSTVVLIGIVSTLSLWAIMPLLVLFYGAYLYYQNT
AREVKRMDSISRSPVYAQFGEALNGLSTIRAYKAYDRMADINGRSMDNNIRFTLVNMGAN
RWLGIRLETLGGLMIWLTASFAVMQNGRAENQQAFASTMGLLLSYALNITSLLTGVLRLA
SLAENSLNAVERVGNYIEIPPEAPPVIENNRPPPGWPSSGSIKFEDVVLRYRPQLPPVLH
GVSFFIHPTDKVGIVGRTGAGKSSLLNALFRIVEVEKGRILIDDCDVGKFGLMDLRKVLG
IIPQSPVLFSGTVRFNLDPFGEHNDADLWESLERAHLKDTIRRNPLGLDAEVSEAGENFS
VGQRQLLSLSRALLRRSKILVLDEATAAVDVRTDALIQKTIREEFKSCTMLIIAHRLNTI
IDCDKILVLDSGRVQEFSSPENLLSNEGSSFSKMVQSTGAANAEYLRSLVLDNKRAKDDS
HHLQGQRKWLASSRWAAAAQFALAASLTSSHNDLQSLEIEDDSSILKRTNDAVVTLRSVL
EGKHDKEIAESLEEHNISREGWLSSLYRMVEGLAVMSRLARNRMQQPDYNFEGNTFDWDN
VEM
NT seq 4872 nt   +upstreamnt  +downstreamnt
atggggtttgagtttattgaatggtattgtaagccggtgcctaatggtgtttggacaaaa
caagtggctaatgcatttggtgcatacacgccttgtgctactgactcttttgtgcttggt
atctctcaactggttctgttggttctgtgcctgtatcgtatatggctcgccttaaaggat
cacaaggtggagaggttctgtttgaggtcaagattgtataactatttcctggctttgttg
gctgcgtatgctactgctgagcctttgtttagattgatcatggggatttcagttttagat
tttgatggacctggacttcctccttttgaggcattcggattgggtgtcaaagcttttgct
tggggcgctgtaatggtcatgattttaatggaaactaaaatttacatccgtgaactccgt
tggtatgtcaggtttgctgtcatatatgctcttgtgggggatatggtcttgttaaatctt
gttctctcagtcaaggagtactatagcagttatgttctgtatctctacacaagcgaagtg
ggagctcaggttctgtttggaattctcttgtttatgcatcttcccaatttggatacttac
cctggctacatgccagtgcggagtgaaactgtggatgattatgagtatgaagagatttct
gatggacaacaaatatgccctgagaagcatgcaaatatatttgacaaaatcttcttctca
tggatgaatcccttgatgactttgggatctaaaaggcctctaacagagaaggatgtgtgg
tatctagacacttgggatcagactgaaactctgttcacgagtttccagcattcctgggat
aaggaactacaaaagccgcaaccgtggctgttgagagcattgaacaatagcctgggagga
aggttttggtggggaggattttggaagatcgggaatgattgctcacagtttgtgggacct
cttttactgaatcaactcttaaagtcaatgcaagaggatgcgccagcttggatgggttac
atctatgcgttctcaatctttgttggagtggtgttcggggtgctatgtgaagctcaatat
ttccagaatgtcatgcgtgttggttaccgactgagatctgctctgattgctgctgtgttc
cgcaaatcgttgaggttaactaatgaaggtcgtagaaagtttcaaacaggaaagataacc
aacttaatgacgactgatgccgaatctcttcagcaaatatgccaatcacttcataccatg
tggtcggctccatttcgtataattatagcactgattctcctctatcagcaattgggtgtt
gcctcgctcattggtgcattgttgttggtccttatgttccctttacagactgttattata
agcaaaatgcagaagctgacaaaggaaggtctgcagcgtactgacaagagaattggcctt
atgaatgaagttttagctgcaatggatacagtaaagtgttatgcttgggaaaacagtttc
cagtccaaggtccaaactgttcgtgatgatgaattatcttggttccggaaatcacagctc
ctgggagcgttgaatatgttcatactgaatagcattcctgttcttgtgactattgtttca
tttggtgtgttcacattacttggaggagacctgacccctgcaagagcatttacgtcactc
tctctctttgctgtgcttcgtttccctctcttcatgcttccaaacattataactcaggtg
gtaaatgctaatgtatccttaaaacgtcttgaggaggtattggcgacagaagaaagaatt
ctcttaccaaatcctcccattgaacctggagagccagccatctcaataagaaatggatat
ttctcttgggattctaagggggataggccgacgttgtcaaatatcaacttggatgtacct
cttggcagcctagttgctgtggttggtagtacaggcgaaggaaaaacctctctaatatct
gctatccttggtgaacttcctgcaacatctgatgcaatagttactctcagaggatcagtt
gcttatgttccacaagtttcatggatctttaatgcaacagtacgcgacaatatactgttt
ggttctcctttcgaccgtgaaaagtatgaaagggccattgatgtgacttcactgaagcat
gacctagagttactgcctggtggtgatctcacggagattggagaaagaggtgttaatatc
agtggaggacagaagcagagggtttccatggctagggccgtttactcaaattcagatgtg
tacatctttgatgacccgttaagtgcccttgatgctcatgttggtcaacaggtttttgaa
aaatgcataaaaagagaactggggcagaaaacgagagttcttgttacaaaccagctccac
ttcctatcacaagtggacagaattgtacttgtgcatgaaggcacagtgaaagaggaagga
acatatgaagagctatccagtaatggccctttgttccagaggctaatggaaaatgcaggg
aaggtggaagaatattcagaagaaaatggagaagctgaggcagatcaaacagcggaacaa
ccagttgcgaatgggaacacaaatggtcttcaaatggatggaagtgacgataaaaaatcc
aaagaaggaaataaaaaaggagggaaatctgtcctcatcaagcaagaagaacgtgaaacc
ggagttgtaagttggagagtcctgaagaggtaccaggatgcacttggaggggcatgggta
gtgatgatgctccttttatgttacgtcttaacagaagtatttcgggttactagcagcacg
tggttgagtgagtggactgatgcaggaactccaaagagtcatggaccccttttctacaat
ctcatatatgcacttctctcgtttggacaggttttggtgacattgaccaattcatattgg
ttgattatgtccagtctttatgcagctaagaagttacacgacaatatgcttcattccata
ctgagggccccgatgtccttcttccataccaatccgctaggacggataatcaatcgattc
gcaaaagatctgggtgatattgatcgaactgtggccgtctttgtaaacatgtttatgggt
caagtctcacagcttctttcaactgtagtgttgattggcattgtaagcactttgtccttg
tgggccatcatgcccctcctggtcttgttttatggagcttatctttattatcagaacaca
gcccgtgaggttaagcgtatggattcaatttcaagatcgcctgtttatgcacagtttgga
gaggcattgaatggcttatcaactatccgtgcttacaaagcatatgatcgtatggctgat
atcaacggaagatcaatggataataacatcagattcactcttgtcaacatgggtgccaat
cggtggcttggaatccgtttagaaactctgggtggtcttatgatatggctgacagcatcg
tttgctgtcatgcagaatggaagagcggagaaccaacaggcatttgcatctacaatgggt
ttgcttctcagttatgccttaaatattactagcttgttaacaggtgttctgagacttgcg
agtttggctgagaatagtctaaacgcggtcgagcgtgttggcaattatatagagattccg
ccagaggctccgcctgtcattgagaacaaccgtccacctcctggatggccatcatctgga
tccataaagtttgaggatgttgttctccgttaccgccctcagttaccgcctgtgcttcat
ggggtttctttcttcattcatccaacagataaggtggggattgttggaaggactggtgct
ggaaagtcaagcctgttgaatgcattgtttagaattgtggaggtggaaaaaggaaggatc
ttaatcgatgattgtgacgttggaaagtttggactgatggacctacgtaaagtgctcgga
atcattccacagtcaccggttcttttctcaggaactgtgaggttcaatcttgatccattt
ggtgaacacaatgatgctgatctttgggaatctctagagagggcacacttgaaggatacc
atccgcagaaatcctcttggtcttgatgctgaggtctctgaggcaggagagaatttcagc
gtgggacagaggcaattgttgagtctttcacgtgcgctgttacggagatctaagatactc
gtccttgatgaagcaactgctgctgtagatgttagaaccgatgccctcattcagaagact
atccgagaagaattcaagtcatgcacgatgctcattatcgctcaccgtctcaataccatc
attgactgtgacaaaattctcgtgcttgattctggaagagttcaagaattcagttcaccg
gagaaccttctttcaaatgaaggaagctctttctccaagatggttcaaagcactggagct
gcaaatgctgagtacttgcgtagtttagtactcgacaacaagcgtgccaaagatgactca
caccacttacaaggccaaaggaaatggctggcttcttctcgctgggctgcagccgctcag
tttgctctggctgcgagtcttacttcgtcgcacaacgatcttcaaagccttgaaattgaa
gatgacagcagcattttgaagagaacaaacgatgcagttgtgactctgcgcagtgttctc
gaggggaaacacgacaaagagattgcagagtcgcttgaggaacataatatctctagagag
ggatggttgtcatcactctatagaatggtagaagggcttgcagtgatgagcagattggca
aggaaccgaatgcaacaaccggattacaatttcgaaggaaatacatttgactgggacaac
gtcgagatgtag

DBGET integrated database retrieval system