KEGG   Arabidopsis thaliana (thale cress): AT2G35230Help
Entry
AT2G35230         CDS       T00041                                 

Gene name
IKU1
Definition
(RefSeq) VQ motif-containing protein
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: VQ
Motif
Other DBs
NCBI-GeneID: 818090
NCBI-ProteinID: NP_001324419
MIPS: AT2G35230.1
TAIR: AT2G35230
Araport: AT2G35230
UniProt: O82170 A0A178VN96
Position
2
AA seq 402 aa AA seqDB search
MDRPRQNDHLGVNRIGKNIRKSPLHQSTFAASTSNGAAPRLQTQPQVYNISKNDFRSIVQ
QLTGSPSRESLPRPPQNNSLRPQNTRLQRIRPSPLTQLNRPAVPLPSMAPPQSHPQFARQ
PPHQPPFPQTTQQPMMGHRDQFWSNTAESPVSEYMRYLQSSLGDSGPNANQMQPGHEQRP
YIPGHEQRPYVPGNEQQPYMPGNEQRPYIPGHEQRSYMPAQSQSQSQPQPQPQPQQHMMP
GPQPRMNMQGPLQPNQYLPPPGLVPSPVPHNLPSPRFNAPVPVTPTQPSPMFSQMYGGFP
SPRYNGFGPLQSPTSQFLQPSPTGYPNMFSPRSPYPLLSPGVQYPQPLTPNFSFSQIAQQ
GSLGPGAGPSQGPPQPPPSPGLMFPLSPSGFFPMPSPRWNDY
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggataggcctagacaaaatgatcatttgggtgtgaataggattgggaaaaatatcaga
aagagtcctcttcatcaatcgactttcgctgccagtactagcaacggtgccgctccaagg
cttcaaacacagcctcaggtttataacataagcaagaacgactttagaagtattgttcag
cagctaacgggttctccatcacgtgaaagccttcctcggcctcctcagaacaactcgcta
aggcctcagaatacacggttgcagcggatcagaccatcccccttaacgcagttaaaccgg
cctgcggttcctctcccttccatggctccgccacagtctcatcctcagtttgctagacag
cctccacaccagccacctttcccacaaaccacacaacaaccaatgatgggtcacagggac
cagttttggtctaatacagctgagtctcccgtctcagagtatatgcgttatcttcaaagt
tcacttggagattcaggacccaatgctaaccaaatgcagccaggtcatgagcagcggcct
tatatcccaggtcatgagcaacggccatatgtgccaggtaatgagcagcagccatatatg
ccaggtaatgagcagcggccatatatcccaggtcatgagcagcggtcatatatgccagct
caatctcagtctcagtctcaacctcaacctcaacctcaacctcagcaacatatgatgcct
ggaccgcaacctcgaatgaacatgcagggccctcttcaacctaaccagtatctaccacca
cccgggttagttcctagcccagtgcctcataatcttccttctcctcggttcaatgctcct
gtacctgtgacgcctactcagccctctcccatgttcagtcagatgtatggtggatttcct
tctcctcgatataacggttttggaccactgcagtcacctacatcccaatttcttcaacca
tctcctaccggttacccgaatatgttctctccgagatcgccttacccattgctgtcacca
ggagttcagtatcctcaaccacttaccccaaacttctcattttcacaaattgctcaacaa
ggaagtcttggacccggtgcaggtccaagtcaaggtcctcctcagcctcctccttctcca
gggctcatgttcccgttatctccatccgggttcttccccatgccaagtccaagatggaat
gattactag

DBGET integrated database retrieval system