KEGG   Arabidopsis thaliana (thale cress): AT2G36190Help
Entry
AT2G36190         CDS       T00041                                 

Gene name
cwINV4
Definition
(RefSeq) cell wall invertase 4
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00052  Galactose metabolism
ath00500  Starch and sucrose metabolism
ath01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    AT2G36190 (cwINV4)
   00500 Starch and sucrose metabolism
    AT2G36190 (cwINV4)
Enzymes [BR:ath01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     AT2G36190 (cwINV4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C
Motif
Other DBs
NCBI-GeneID: 818191
NCBI-ProteinID: NP_565837
MIPS: AT2G36190.1
TAIR: AT2G36190
Araport: AT2G36190
UniProt: Q8W413
Position
2
AA seq 591 aa AA seqDB search
MAISNVISVLLLLLVLINLSNQNIKGIDAFHQIYEELQSESVESVNHLHRPSFHFQPPKH
WINDPNGPVYYKGLYHLFYQYNTKGAVWGNIIWAHSVSKDLVNWEALEPALSPSKWFDIG
GTWSGSITIVPGKGPIILYTGVNQNETQLQNYAIPEDPSDPYLRKWIKPDDNPIAIPDYT
MNGSAFRDPTTAWFSKDGHWRTVVGSKRKRRGIAYIYRSRDFKHWVKAKHPVHSKQSTGM
WECPDFFPVSLTDFRNGLDLDYVGPNTKHVLKVSLDITRYEYYTLGKYDLKKDRYIPDGN
TPDGWEGLRFDYGNFYASKTFFDYKKNRRILWGWANESDTVEDDILKGWAGLQVIPRTVL
LDSSKKQLVFWPVEEIESLRGNYVRMNNHDIKMGQRIEVKGITPAQADVEVTFYVGSLEK
AEIFDPSFTWKPLELCNIKGSNVRGGVGPFGLITLATPDLEEYTPVFFRVFNDTKTHKPK
VLMCSDARPSSLKQDTGLLAKDRMYKPSFAGFVDVDMADGRISLRSLIDHSVVESFGALG
KTVITSRVYPVKAVKENAHLYVFNNGTQTVTIESLNAWNMDRPLQMNDGAL
NT seq 1776 nt NT seq  +upstreamnt  +downstreamnt
atggctatttcaaatgttatttctgtcttattattattgcttgtactaatcaatttaagc
aatcaaaatatcaaaggaattgatgcatttcatcagatttacgaagaattgcaatctgaa
tcagtcgagtcagtgaatcatcttcacagacctagttttcactttcaacctccaaagcat
tggattaacgatccaaatggtccagtatactacaaaggtctctaccatctcttctaccaa
tataacaccaaaggtgcggtttggggtaatattatatgggcccattcggtttctaaagac
ttggttaactgggaggctcttgaaccggctcttagtccttcaaaatggttcgacatcgga
ggtacatggtccggttcaataacaatcgtaccgggaaaaggaccgattatcctctatacc
ggtgttaaccagaacgaaactcagttgcaaaactatgcaatcccagaggacccatcagac
ccatacctaaggaaatggattaaaccggacgataacccgattgcaatcccagactataca
atgaacggttcagcattccgtgacccgacaaccgcttggttctccaaagacgggcattgg
agaaccgtggtagggtcaaaaagaaagcgtagaggaattgcttacatctacagaagccga
gatttcaagcattgggtcaaagctaagcacccggttcactctaaacagtcaaccggtatg
tgggaatgtcctgatttcttcccggtttccttaaccgatttccgaaacggtttggacttg
gattacgtcggtccaaacaccaagcatgtgttgaaggttagcttggacattacccggtac
gagtattacacgcttggtaaatacgatcttaagaaggaccggtacataccggacggtaat
actcccgatggttgggagggtttaagattcgattacggtaatttctacgcttccaagaca
ttctttgactacaaaaagaacagaagaatcttatggggttgggctaatgaatctgacacc
gttgaagatgatattttgaagggttgggctggtcttcaggtgattccaagaacggtgctc
cttgattcaagcaagaagcaacttgtgttttggcctgttgaagagatagagtcattaaga
ggtaactacgtccgaatgaacaatcatgacatcaagatgggtcaacgcatagaagtcaaa
ggaatcactcctgctcaagccgatgtggaagtaacgttctatgttggaagtctagagaaa
gctgagatattcgatccgagtttcacgtggaaaccattggaattgtgtaacattaaaggc
tcgaatgtgagaggcggtgtaggaccttttggtctgatcacattagcgactcctgatttg
gaagagtacactcctgtcttctttagagtcttcaacgacactaaaactcataagcctaaa
gttctcatgtgctccgatgctagaccgtcgtcgttaaagcaagacacgggtttactcgca
aaagataggatgtataaaccatcgtttgctggttttgtggatgttgatatggctgatgga
aggatctctctaaggagtttgattgatcattcagtagtagagagctttggagcattaggt
aaaacggtgataacatcaagagtgtatccagtgaaagcagtaaaagagaatgcacatttg
tatgtctttaacaatggaacacaaactgtgaccatagagagtctcaatgcttggaatatg
gatcgtcctctgcaaatgaatgatggagctctttaa

DBGET integrated database retrieval system