KEGG   Arabidopsis thaliana (thale cress): AT2G36910Help
Entry
AT2G36910         CDS       T00041                                 

Gene name
ABCB1
Definition
(RefSeq) ATP binding cassette subfamily B1
  KO
K05658  ATP-binding cassette, subfamily B (MDR/TAP), member 1 [EC:7.6.2.2]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:ath00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    AT2G36910 (ABCB1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ath02000]
    AT2G36910 (ABCB1)
   04147 Exosome [BR:ath04147]
    AT2G36910 (ABCB1)
   04090 CD molecules [BR:ath04090]
    AT2G36910 (ABCB1)
Enzymes [BR:ath01000]
 7. Translocases
  7.6  Catalysing the translocation of other compounds
   7.6.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.6.2.2  ABC-type xenobiotic transporter
     AT2G36910 (ABCB1)
Transporters [BR:ath02000]
 ABC transporters, eukaryotic type
  ABCB (MDR/TAP) subfamily
   ABCB1, 4, 5 subgroups
    AT2G36910 (ABCB1)
Exosome [BR:ath04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AT2G36910 (ABCB1)
CD molecules [BR:ath04090]
 Proteins
  AT2G36910 (ABCB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ABC_membrane ABC_tran SMC_N AAA_16 Zeta_toxin AAA_22 RsgA_GTPase AAA_15 ABC_ATPase AAA_29 AAA_30 AAA_5 G-alpha AAA DUF87 SbcCD_C DUF815 APS_kinase AAA_25 Rad17
Motif
Other DBs
NCBI-GeneID: 818265
NCBI-ProteinID: NP_181228
MIPS: AT2G36910.1
TAIR: AT2G36910
Araport: AT2G36910
UniProt: Q9ZR72
Position
2
AA seq 1286 aa AA seqDB search
MDNDGGAPPPPPTLVVEEPKKAEIRGVAFKELFRFADGLDYVLMGIGSVGAFVHGCSLPL
FLRFFADLVNSFGSNSNNVEKMMEEVLKYALYFLVVGAAIWASSWAEISCWMWSGERQTT
KMRIKYLEAALNQDIQFFDTEVRTSDVVFAINTDAVMVQDAISEKLGNFIHYMATFVSGF
IVGFTAVWQLALVTLAVVPLIAVIGGIHTTTLSKLSNKSQESLSQAGNIVEQTVVQIRVV
MAFVGESRASQAYSSALKIAQKLGYKTGLAKGMGLGATYFVVFCCYALLLWYGGYLVRHH
LTNGGLAIATMFAVMIGGLALGQSAPSMAAFAKAKVAAAKIFRIIDHKPTIERNSESGVE
LDSVTGLVELKNVDFSYPSRPDVKILNNFCLSVPAGKTIALVGSSGSGKSTVVSLIERFY
DPNSGQVLLDGQDLKTLKLRWLRQQIGLVSQEPALFATSIKENILLGRPDADQVEIEEAA
RVANAHSFIIKLPDGFDTQVGERGLQLSGGQKQRIAIARAMLKNPAILLLDEATSALDSE
SEKLVQEALDRFMIGRTTLIIAHRLSTIRKADLVAVLQQGSVSEIGTHDELFSKGENGVY
AKLIKMQEAAHETAMSNARKSSARPSSARNSVSSPIMTRNSSYGRSPYSRRLSDFSTSDF
SLSIDASSYPNYRNEKLAFKDQANSFWRLAKMNSPEWKYALLGSVGSVICGSLSAFFAYV
LSAVLSVYYNPDHEYMIKQIDKYCYLLIGLSSAALVFNTLQHSFWDIVGENLTKRVREKM
LSAVLKNEMAWFDQEENESARIAARLALDANNVRSAIGDRISVIVQNTALMLVACTAGFV
LQWRLALVLVAVFPVVVAATVLQKMFMTGFSGDLEAAHAKGTQLAGEAIANVRTVAAFNS
EAKIVRLYTANLEPPLKRCFWKGQIAGSGYGVAQFCLYASYALGLWYASWLVKHGISDFS
KTIRVFMVLMVSANGAAETLTLAPDFIKGGQAMRSVFELLDRKTEIEPDDPDTTPVPDRL
RGEVELKHIDFSYPSRPDIQIFRDLSLRARAGKTLALVGPSGCGKSSVISLIQRFYEPSS
GRVMIDGKDIRKYNLKAIRKHIAIVPQEPCLFGTTIYENIAYGHECATEAEIIQAATLAS
AHKFISALPEGYKTYVGERGVQLSGGQKQRIAIARALVRKAEIMLLDEATSALDAESERS
VQEALDQACSGRTSIVVAHRLSTIRNAHVIAVIDDGKVAEQGSHSHLLKNHPDGIYARMI
QLQRFTHTQVIGMTSGSSSRVKEDDA
NT seq 3861 nt NT seq  +upstreamnt  +downstreamnt
atggataatgacggtggtgctcctcctcctccgccgacactagtggtggaagagcctaag
aaagcagagattcgtggagttgcttttaaagagctattcagattcgccgacggattagat
tatgtattgatgggaattggctctgttggtgcttttgtccatggctgctctttacctctg
tttcttcgattcttcgccgatcttgttaattcctttggttctaattctaataacgttgaa
aagatgatggaagaagttctcaagtatgcgctttactttttagtggttggtgctgcaatc
tgggcttcctcttgggcagagatttcgtgttggatgtggagtggagagagacaaacaacg
aagatgaggattaagtatttagaagcagctttgaatcaagacattcagttctttgataca
gaagttcgaacttcagatgttgtcttcgccattaacaccgacgctgttatggttcaagac
gccattagtgagaaacttggtaatttcatccattacatggcgacttttgtttctggattc
atcgtgggtttcactgcggtgtggcaactagctttagtgactctcgcggtggttccgttg
attgctgtgatcggaggaattcacaccactactctctctaaactatctaataagagtcaa
gagtctctttcacaagctggtaatatcgtcgaacagacagtggtacaaatcagggtagtg
atggctttcgttggagaatcaagagcttcacaagcttattcatcagctttgaagattgct
cagaagcttggttacaaaacaggtttagctaaaggaatgggacttggtgctacatacttc
gttgtcttttgttgttacgctctcttgctttggtacggtggttatctagttcgccaccat
ttgaccaacggtggtctcgctattgccacaatgttcgccgttatgattggtggattggca
ttgggacaatcagcaccgagcatggctgcatttgccaaagcaaaggttgctgctgcaaag
atctttagaatcattgatcacaaaccaacgatagagcgtaacagcgagtccggtgtggag
ttagactcagtcacgggtcttgtcgagcttaaaaatgtggacttttcgtatccgtcaagg
ccagatgttaagattcttaacaacttctgcctctctgttcctgctgggaagaccattgct
ttggttgggagcagtggttcaggaaaaagcacagtcgtttcgcttatagagcggttttac
gacccgaactcaggacaagttttactagatgggcaagacctgaagacgctgaaactgaga
tggttaaggcaacagatagggctagtgagtcaagaacctgcattattcgccacttctatc
aaggagaatatactcttaggccgtcctgacgcagatcaagtcgagatagaggaggctgct
cgagtcgcaaatgctcattcctttatcatcaaactacctgatggcttcgacacacaggtt
ggggagagaggattgcagctgtctggtgggcagaagcaaagaatagcgatagcaagagcg
atgttgaagaacccggcgatacttctattagatgaggcgacgagtgcattggattctgaa
tcagagaagcttgtacaagaggctttggatcgtttcatgattggaaggactactctcatc
attgctcatcgcctttctaccattcgaaaagctgaccttgttgctgtgctacagcaagga
agtgtctctgagattggaacgcatgatgagcttttttccaagggagaaaatggagtctat
gctaagctaattaaaatgcaagaagcagctcacgaaaccgccatgagcaatgcaagaaag
agtagcgcaagaccgtcgagtgctagaaactcggttagctcgccaataatgactcggaat
tcgtcgtatggaagatcaccttattcacggagactatccgatttctcaacttctgatttt
agcctctccattgacgcttcgtcctacccaaactatagaaacgagaagctggccttcaag
gatcaagccaattcattctggcgactagctaaaatgaactctccagagtggaaatacgct
ttgctcggttcagtaggctctgtcatttgtggctcccttagtgcattcttcgcatatgtc
ctcagtgcagtcttaagcgtctactacaacccggaccacgaatacatgatcaaacagatt
gataagtactgttatctcttaatcggtctctcttccgcagcacttgtcttcaacacgctc
cagcattctttctgggacattgtgggtgagaatctgaccaagagagtccgtgagaagatg
ctgagcgctgtactcaagaatgagatggcttggtttgatcaagaggagaacgaaagtgca
agaatcgcagcaagattagctcttgatgctaataatgtgagatctgcgataggagataga
atatcggttattgtgcagaacacagcactgatgcttgttgcttgcactgccgggtttgtt
ctacaatggagactcgcacttgtccttgtcgcagtcttccccgtagttgttgctgcaact
gtcttacagaaaatgttcatgactggtttctcgggagacctggaagcggcacatgccaag
ggaacgcagcttgctggtgaagccatagctaatgtcaggacagttgctgcatttaactcg
gaggcaaagattgtccgtctctacactgcaaacctcgaaccaccattgaaacgatgcttc
tggaaaggacagatcgctggaagtggttatggtgtagctcagttctgtctttatgcatct
tatgctctcgggctatggtacgcatcatggcttgtgaaacacggcatctctgacttctcc
aaaaccataagagtcttcatggttctgatggtctcagccaatggtgcagcagagacactc
acactggctcctgatttcatcaaaggtggtcaagctatgcggtctgttttcgaacttctt
gaccggaaaaccgagattgaacctgatgatcctgataccaccccggtcccagaccggtta
cgtggtgaagtcgagctcaaacatatcgatttctcttacccttcaaggccagacatccag
attttccgtgaccttagccttcgtgctagagctggcaaaaccctagctcttgtgggtcca
agcgggtgcggaaaaagctcagttatctccctcatccagagattctacgaaccttcctca
ggccgagtcatgatcgacgggaaagacataaggaaatacaacctgaaagccataaggaaa
cacatagccatagtccctcaagagccgtgcttgttcggaactaccatttacgaaaacatt
gcatatggacatgaatgtgcgaccgaagcagagatcatacaagccgcgactctagccagt
gcgcacaaattcatatccgcgctaccagaaggttacaaaacgtatgttggcgagagaggc
gttcagctctcgggaggacagaaacagaggatcgcgatcgcacgtgccctcgtgaggaaa
gcagagatcatgctgcttgacgaggctacaagcgctcttgatgcagagtccgagagatca
gtccaagaagcattagaccaggcttgctctggtagaacatcaatagtcgtggctcatagg
ctatctacaatcaggaacgcacacgtgatcgctgtcatcgatgatggaaaagtggctgaa
caaggatcgcattcgcatcttctcaagaaccatcctgatggaatctacgcgcgaatgata
cagttgcaaagatttacgcatacacaagtgattggtatgacgtcaggttcaagttctagg
gttaaggaagatgatgcttag

DBGET integrated database retrieval system