KEGG   Arabidopsis thaliana (thale cress): AT2G37320Help
Entry
AT2G37320         CDS       T00041                                 

Definition
(RefSeq) Tetratricopeptide repeat (TPR)-like superfamily protein
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: PPR_2 PPR PPR_1 PPR_3 PPR_long TPR_7 DYW_deaminase TPR_9
Motif
Other DBs
NCBI-GeneID: 818309
NCBI-ProteinID: NP_181269
MIPS: AT2G37320.1
TAIR: AT2G37320
Araport: AT2G37320
UniProt: Q9ZUT4 A0A178VTH9
Position
2
AA seq 500 aa AA seqDB search
MSCLRNYYCRAFGYKQSRSCYSRSLNREIANESSEVERRARSLRVLDIISSKSGGVSNRQ
DHFGFVQEFRQTDSWRFRGQAISEDFDLSRTKNGVSSVLEEVMLEDSSSSVKRDGWSFDA
YGLSSAVRSCGLNRDFRTGSGFHCLALKGGFISDVYLGSSLVVLYRDSGEVENAYKVFEE
MPERNVVSWTAMISGFAQEWRVDICLKLYSKMRKSTSDPNDYTFTALLSACTGSGALGQG
RSVHCQTLHMGLKSYLHISNSLISMYCKCGDLKDAFRIFDQFSNKDVVSWNSMIAGYAQH
GLAMQAIELFELMMPKSGTKPDAITYLGVLSSCRHAGLVKEGRKFFNLMAEHGLKPELNH
YSCLVDLLGRFGLLQEALELIENMPMKPNSVIWGSLLFSCRVHGDVWTGIRAAEERLMLE
PDCAATHVQLANLYASVGYWKEAATVRKLMKDKGLKTNPGCSWIEINNYVFMFKAEDGSN
CRMLEIVHVLHCLIDHMEFL
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgtcttgtctgagaaattattattgtcgagctttcggttataaacagtctcgatcttgc
tacagtcgatcactgaatcgtgaaatagctaacgagtcatctgaagttgagagacgagct
cgttctctgagagttttggatatcatatcttcgaaatctggtggagtttcgaatcgtcag
gaccattttggtttcgttcaggaatttcgacaaacagattcgtggcgattcagaggtcag
gcaatttccgaggattttgatctctcaagaaccaaaaatggagtttcaagcgtgctcgaa
gaagttatgctggaggattcttcaagctctgtcaagcgagatggatggagtttcgatgct
tatggtttatcatccgccgtgagatcttgtgggttgaatcgagactttagaaccggttct
gggtttcattgtttagcgttgaaaggtgggtttatctcagatgtctacttaggaagttct
ctggtcgttttgtacagagattctggtgaagtagagaatgcatataaagtgtttgaagaa
atgcctgagaggaatgtggtttcatggacggctatgatttcagggtttgcgcaagaatgg
cgagttgatatctgcttgaagctttattcaaagatgagaaagtcaacctctgatccgaat
gattacacattcacggctctcttgagcgcttgcacgggaagcggagccctagggcaagga
agaagtgttcattgtcagacactccacatgggattgaagtcgtatctacatatctcaaac
tctctcatctcgatgtactgcaaatgcggtgatttgaaggatgcttttcgtatctttgac
cagttttcaaacaaagacgttgtttcttggaactctatgattgctggttacgcgcagcac
ggccttgcaatgcaagcaatcgagctctttgaattaatgatgcctaaaagcggaacaaag
ccagatgcaatcacatatctaggagttttgtcatcgtgtagacacgcaggtcttgtaaaa
gaaggaagaaagttcttcaatttgatggcggaacacggcctgaaaccagaactcaaccat
tactcttgtctagtcgatcttctcgggagatttggtctgttgcaagaagccctggaactg
atcgagaacatgccaatgaaaccaaactcagtcatatggggatctctgctattctcttgc
cgtgttcacggcgatgtctggaccggaatcagagctgcagaggaacgactaatgcttgaa
cctgattgcgcagccacgcatgtccagctggcaaatctttacgccagtgtagggtactgg
aaagaagcggcgacagtgaggaagctgatgaaagataaaggactgaagacgaatccgggt
tgcagttggatcgagatcaataactatgttttcatgtttaaagctgaagatggtagcaac
tgtagaatgctagagattgttcatgttcttcattgtctcattgatcacatggagttcctc
taa

DBGET integrated database retrieval system