KEGG   Arabidopsis thaliana (thale cress): AT2G37500
Entry
AT2G37500         CDS       T00041                                 
Name
(RefSeq) arginine biosynthesis protein ArgJ family
  KO
K00620  glutamate N-acetyltransferase / amino-acid N-acetyltransferase [EC:2.3.1.35 2.3.1.1]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00220  Arginine biosynthesis
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
ath01210  2-Oxocarboxylic acid metabolism
ath01230  Biosynthesis of amino acids
Module
ath_M00028  Ornithine biosynthesis, glutamate => ornithine
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    AT2G37500
Enzymes [BR:ath01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.1  amino-acid N-acetyltransferase
     AT2G37500
    2.3.1.35  glutamate N-acetyltransferase
     AT2G37500
SSDB
Motif
Pfam: ArgJ
Other DBs
NCBI-GeneID: 818326
NCBI-ProteinID: NP_565863
TAIR: AT2G37500
UniProt: Q9ZUR7 A0A178VUS6
Position
2:complement(15739783..15742838)
AA seq 468 aa
MHSCSHTHFVSFKLPHFFAPKSFVVSSRRELRVFAVATTVEEASGNIPAAPISLPQGSWK
QIAGGVTAAKGFKAAGMYAGLRAAGKKPDLALVTCDVEAVAAGVFTTNVVAAAPVVYCKK
VLETSKTARAVLINAGQANAATGDAGYQDMLDCVGSIATLLKVKPEEVLIESTGVIGQRI
KKEELLHALPTLVNSRSDSVEEADSAAVAITTTDLVSKSVAVESQVGGIKIRVGGMAKGS
GMIHPNMATMLGVITTDALVESDIWRKMVKVAVNRSFNQITVDGDTSTNDTVIALASGLS
GSPSISSLNCKEAAQLQACLDAVMQGLAKSIAWDGEGATCLIEVTVKGTETEAEAAKIAR
SVASSSLVKAAVYGRDPNWGRIAAAAGYAGVSFQMDKLKISLGEFSLMESGQPLPFDRDG
ASNYLKKTGEVHGTVTIDISVGDGAAIGKAWGCDLSYDYVKINAEYTS
NT seq 1407 nt   +upstreamnt  +downstreamnt
atgcattcttgttctcatactcacttcgtatctttcaagcttcctcatttcttcgcgcct
aagagttttgtggtgtcttcacggagagaattaagagtgttcgcagtggcaactaccgtc
gaggaggcgtccggtaacataccagcggctccgatttctctacctcaagggtcatggaaa
cagatagctggtggagttacagctgctaaagggtttaaagctgctggtatgtatgctgga
ttacgagctgcagggaagaaacctgatctcgctcttgtaacatgtgatgtcgaagctgta
gctgcaggtgtgtttactactaatgtggttgctgctgctcctgtagtttactgtaaaaaa
gttcttgagacttcgaaaacggctcgtgcagtgttgatcaatgccggtcaggccaatgca
gctacgggtgatgctggttaccaagatatgttagattgtgttggatctattgcgacgcta
cttaaagtgaagccagaggaagtgttaattgagtcaactggtgttatcggtcagagaata
aaaaaggaagagcttctccacgcacttccaactctagtcaactcgagatcagactctgtg
gaagaggcagattctgctgctgtagctatcacaacaacagatcttgtaagcaagagtgtt
gcagttgaatcacaggttggtggaatcaaaattcgagttggtggtatggctaaaggctcc
gggatgatccatcccaatatggcaactatgttaggtgtcatcacaacagatgcactagtt
gaaagtgatatctggagaaagatggtaaaggttgcagttaaccgaagtttcaaccagatc
actgtagatggagacacgagtactaacgacacagtcattgctttagctagcgggctatct
ggatcaccttctatatcatctttgaactgtaaagaagctgcacagcttcaggcatgcctc
gatgcggtgatgcaaggacttgctaaatcaatagcttgggatggtgaaggtgctacatgt
ctcatcgaggtaactgttaaaggaacagaaactgaagcagaagcagcgaaaattgcacgc
tctgtggcttcctcttccctggtcaaagcagctgtttatgggagagatccaaactgggga
cgcatagctgcagctgctggctatgccggggtttcttttcagatggataagctgaagata
tccctcggcgagttctcactcatggagagtggtcaacctcttccgtttgacagggatgga
gcaagtaactacctcaagaaaaccggtgaggttcacggaacagttacaatcgatatatcc
gtaggtgatggtgcagccatcggaaaggcatggggatgcgatcttagctatgactatgtc
aagatcaacgctgagtacacctcatag

DBGET integrated database retrieval system