KEGG   Arabidopsis thaliana (thale cress): AT2G37690
Entry
AT2G37690         CDS       T00041                                 
Name
(RefSeq) phosphoribosylaminoimidazole carboxylase, putative / AIR carboxylase
  KO
K11808  phosphoribosylaminoimidazole carboxylase [EC:4.1.1.21]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00230  Purine metabolism
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
Module
ath_M00048  De novo purine biosynthesis, PRPP + glutamine => IMP
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    AT2G37690
Enzymes [BR:ath01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.21  phosphoribosylaminoimidazole carboxylase
     AT2G37690
SSDB
Motif
Pfam: AIRC ATP-grasp PurK_C Dala_Dala_lig_C CPSase_L_D2 2-Hacid_dh_C GARS_A XdhC_C 3HCDH_N AlaDh_PNT_C
Other DBs
NCBI-GeneID: 818346
NCBI-ProteinID: NP_181305
TAIR: AT2G37690
UniProt: Q84TI2 A0A654EZT9
Position
2:15805659..15810552
AA seq 642 aa
MLLLKQSSAAVLVVGNTTPVLHTSRSTYRVGPFPVTRTQSFQSLTMANLQKLPTSSSGKL
NTASAVPCSSHDASPISENRENKHVHGVSEKIVGVLGGGQLGRMLCQAASQLAIKVMILD
PSKNCSASALSYGHMVDSFDDSATVEEFAKRCGVLTVEIEHVDVDTLEKLEKQGVDCQPK
ASTIRIIQDKYMQKVHFSQHGIPLPEFMEISDIEGARKAGELFGYPLMIKSKRLAYDGRG
NAVANNQDELSSAVTALGGFSRGLYIEKWAPFVKELAVIVARGRDGSMVCYPVVETIHRD
NICHIVKAPADVPWKINKLATDVAQKAVGSLEGAGVFAVELFLTEDSQILLNEVAPRPHN
SGHQTIECCYTSQFEQHLRAVVGLPLGDPSMRTPASIMYNILGEDDGEAGFKLAHRLIAR
ALCIPGASVHWYDKPEMRKQRKMGHITLVGQSMGILEQRLQCILSEQSHQVHETPRVAII
MGSDTDLPVMKDAAKILDLFGVTHEVKIVSAHRTPEMMYTYATSAHSRGVQVIIAGAGGA
AHLPGMVASLTPLPVIGVPVRATRLDGVDSLLSIVQMPRGVPVATVAINNATNAALLAVR
MLGISDTDLVSRMRQYQEDMRDENLNKGEKLETEGWESYLNQ
NT seq 1929 nt   +upstreamnt  +downstreamnt
atgttgcttttgaaacaaagctcagctgctgttcttgtcgttggaaatacaactccagtc
cttcacacttctcgctccacctacagagttggaccttttccagtgaccagaacgcagtcg
ttccagagtttgactatggcaaatttgcagaagcttcccacttcttcgtctgggaaattg
aatacggcttcagctgtgccctgtagctctcacgatgcttctcctatcagtgagaatcgc
gagaataaacatgtccatggagtttctgagaaaattgtgggagttcttgggggtggacaa
ttgggtcgtatgctttgccaagctgcttctcagttggctatcaaagtgatgattttagat
ccttctaaaaattgttcagcaagtgcattgtcctacggtcacatggttgatagctttgac
gacagtgctacagtagaagaatttgcaaaaagatgtggagtcttaactgtagaaattgaa
catgttgacgtggacacactagagaagcttgagaaacaaggagtggattgccaacccaaa
gcttctactattaggataatacaggataaatacatgcaaaaggttcatttctctcagcat
ggcatcccacttccagaatttatggagataagcgatattgaaggagcaagaaaagcaggt
gaacttttcggttaccctcttatgatcaagagcaaacgattggcttatgatggacgtgga
aatgcagttgccaacaaccaagatgagctttcttctgctgtaacggctcttggaggtttc
agtcgtggtttgtatattgagaaatgggcaccttttgttaaggagttagctgttattgtg
gctagggggagagatggttctatggtttgttatcccgttgttgaaaccattcacagggat
aacatatgccatatagttaaagcacctgcagatgtgccttggaagattaacaaacttgcc
accgatgttgcccaaaaggctgtcggttctttagaaggtgctggtgtttttgcagttgaa
ctgttcttgacagaggatagtcagattctgctaaacgaagttgcacctagaccacacaac
agtggccatcaaacgatcgagtgctgttatacttcacagtttgaacaacacttgcgagct
gtggttggtcttccacttggtgatccgtcaatgagaactccggcgtccattatgtacaat
attctgggagaagatgatggagaagcaggtttcaaattggctcatcggcttattgcaagg
gctctgtgtattccaggtgcatctgttcattggtatgacaagccagaaatgagaaagcag
agaaagatgggtcacatcactcttgttgggcagtctatgggcattttggaacaaaggtta
caatgcatattaagtgagcaaagccaccaagtacacgagacacctcgtgttgctatcatc
atgggttcagacacggatcttcctgttatgaaggatgctgccaaaattctggacctgttt
ggtgtgacacatgaggtaaagatagtttctgctcatcgcaccccagagatgatgtataca
tatgcaacctcagctcatagtcgaggcgttcaagtcattattgcaggtgctggtggtgct
gctcacttaccaggtatggttgcttcactcactcctttgcctgtgattggtgtccctgtc
cgtgctacccgtttggatggagttgattcacttctttccatcgttcagatgcctagaggt
gttcctgttgcgacagttgcaataaacaatgcgaccaacgcagccttgcttgcagttcgg
atgttgggaatctctgatacggatcttgtctcaaggatgaggcagtaccaggaagacatg
agagatgagaacctgaataaaggagagaaactggagacagaaggttgggaatcatatttg
aaccagtga

DBGET integrated database retrieval system