KEGG   Arabidopsis thaliana (thale cress): AT2G38130Help
Entry
AT2G38130         CDS       T00041                                 

Gene name
ATMAK3
Definition
(RefSeq) Acyl-CoA N-acyltransferases (NAT) superfamily protein
  KO
K00670  N-alpha-acetyltransferase 30 [EC:2.3.1.256]
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
KEGG Orthology (KO) [BR:ath00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ath04131]
    AT2G38130 (ATMAK3)
Enzymes [BR:ath01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.256  N-terminal methionine Nalpha-acetyltransferase NatC
     AT2G38130 (ATMAK3)
Membrane trafficking [BR:ath04131]
 Endosome - Lysosome transport
  Arf GTPases and associated proteins
   N-acetyl transferase complex C (NatC)
    AT2G38130 (ATMAK3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acetyltransf_1 Acetyltransf_10 Acetyltransf_7 FR47 Acetyltransf_3 Acetyltransf_8 Acetyltransf_9 Acetyltransf_CG Acetyltransf_4
Motif
Other DBs
NCBI-GeneID: 818391
NCBI-ProteinID: NP_181348
MIPS: AT2G38130.1
TAIR: AT2G38130
Araport: AT2G38130
UniProt: O80438
Position
2
AA seq 190 aa AA seqDB search
MEKEMEDKEEFDEGEIEYTSYAGEHHLPLIMSLVDQELSEPYSIFTYRYFVYLWPQLCFL
AFHKGKCVGTIVCKMGDHRQTFRGYIAMLVVIKPYRGRGIASELVTRAIKAMMESGCEEV
TLEAEVSNKGALALYGRLGFIRAKRLYHYYLNGMDAFRLKLLFPKPRVPQIPSQVQTQQE
YETFPRPRVP
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atggagaaagagatggaagataaagaagaattcgatgagggtgagattgagtacacgagt
tatgctggtgagcatcatctgccattgattatgtctcttgttgaccaagaacttagtgaa
ccttactccatctttacttaccggtacttcgtctacctctggccgcagctatgcttcctg
gcctttcacaaaggtaaatgcgtaggaaccatagtctgtaagatgggggatcatcgacag
actttcagagggtacatcgctatgttggttgtgattaaaccatatcgtggccgaggcata
gcctcagagcttgtcacaagagcgataaaagcgatgatggaatcaggctgtgaagaggta
actctggaggcagaagtgagtaacaaaggagcattagcactatatgggcgactcgggttt
ataagagccaaacggctataccactattacttgaatgggatggatgcttttcgcctgaag
ctcttgttccctaagcctcgtgtacctcaaataccttctcaagttcaaacccaacaagag
tatgagacctttcctaggcctcgtgtaccttaa

DBGET integrated database retrieval system