KEGG   Arabidopsis thaliana (thale cress): AT2G39730Help
Entry
AT2G39730         CDS       T00041                                 

Gene name
RCA
Definition
(RefSeq) rubisco activase
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: AAA Torsin
Motif
Other DBs
NCBI-GeneID: 818558
NCBI-ProteinID: NP_565913
MIPS: AT2G39730.1
TAIR: AT2G39730
Araport: AT2G39730
UniProt: P10896
Structure
PDB: 

Position
2
AA seq 474 aa AA seqDB search
MAAAVSTVGAINRAPLSLNGSGSGAVSAPASTFLGKKVVTVSRFAQSNKKSNGSFKVLAV
KEDKQTDGDRWRGLAYDTSDDQQDITRGKGMVDSVFQAPMGTGTHHAVLSSYEYVSQGLR
QYNLDNMMDGFYIAPAFMDKLVVHITKNFLTLPNIKVPLILGIWGGKGQGKSFQCELVMA
KMGINPIMMSAGELESGNAGEPAKLIRQRYREAADLIKKGKMCCLFINDLDAGAGRMGGT
TQYTVNNQMVNATLMNIADNPTNVQLPGMYNKEENARVPIICTGNDFSTLYAPLIRDGRM
EKFYWAPTREDRIGVCKGIFRTDKIKDEDIVTLVDQFPGQSIDFFGALRARVYDDEVRKF
VESLGVEKIGKRLVNSREGPPVFEQPEMTYEKLMEYGNMLVMEQENVKRVQLAETYLSQA
ALGDANADAIGRGTFYGKGAQQVNLPVPEGCTDPVAENFDPTARSDDGTCVYNF
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atggccgccgcagtttccaccgtcggtgccatcaacagagctccgttgagcttgaacggg
tcaggatcaggagctgtatcagccccagcttcaaccttcttgggaaagaaagttgtaact
gtgtcgagattcgcacagagcaacaagaagagcaacggatcattcaaggtgttggctgtg
aaagaagacaaacaaaccgatggagacagatggagaggtcttgcctacgacacttctgat
gatcaacaagacatcaccagaggcaagggtatggttgactctgtcttccaagctcctatg
ggaaccggaactcaccacgctgtccttagctcatacgaatacgttagccaaggccttagg
cagtacaacttggacaacatgatggatgggttttacattgctcctgctttcatggacaag
cttgttgttcacatcaccaagaacttcttgactctgcctaacatcaaggttccacttatt
ttgggtatatggggaggcaaaggtcaaggtaaatccttccagtgtgagcttgtcatggcc
aagatgggtatcaacccaatcatgatgagtgctggagagcttgagagtggaaacgcagga
gaacccgcaaagcttatccgtcagaggtaccgtgaggcagctgacttgatcaagaaggga
aagatgtgttgtctcttcatcaacgatcttgacgctggtgcgggtcgtatgggtggtact
actcagtacactgtcaacaaccagatggttaacgcaacactcatgaacattgctgataac
ccaaccaacgtccagctcccaggaatgtacaacaaggaagagaacgcacgtgtccccatc
atttgcactggtaacgatttctccaccctatacgctcctctcatccgtgatggacgtatg
gagaagttctactgggccccgacccgtgaagaccgtatcggtgtctgcaagggtatcttc
agaactgacaagatcaaggacgaagacattgtcacacttgttgatcagttccctggtcaa
tctatcgatttcttcggtgctttgagggcgagagtgtacgatgatgaagtgaggaagttc
gttgagagccttggagttgagaagatcggaaagaggctggttaactcaagggaaggacct
cccgtgttcgagcaacccgagatgacttatgagaagcttatggaatacggaaacatgctt
gtgatggaacaagagaatgtcaagagagtccaacttgccgagacctacctcagccaggct
gctttgggagacgcaaacgctgacgccatcggccgcggaactttctacggaaaaggagcc
cagcaagtaaacctgccagttcctgaagggtgtactgatcctgtggctgaaaactttgat
ccaacggctagaagtgacgatggaacctgtgtctacaacttttga

DBGET integrated database retrieval system