KEGG   Arabidopsis thaliana (thale cress): AT2G39770Help
Entry
AT2G39770         CDS       T00041                                 

Gene name
CYT1
Definition
(RefSeq) Glucose-1-phosphate adenylyltransferase family protein
  KO
K00966  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00051  Fructose and mannose metabolism
ath00520  Amino sugar and nucleotide sugar metabolism
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
Module
ath_M00114  Ascorbate biosynthesis, plants, glucose-6P => ascorbate
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    AT2G39770 (CYT1)
   00520 Amino sugar and nucleotide sugar metabolism
    AT2G39770 (CYT1)
Enzymes [BR:ath01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     AT2G39770 (CYT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Hexapep Hexapep_2 CTP_transf_3 DUF4954 IspD Fucokinase
Motif
Other DBs
NCBI-GeneID: 818562
NCBI-ProteinID: NP_001189713
MIPS: AT2G39770.1
TAIR: AT2G39770
Araport: AT2G39770
UniProt: O22287 A0A178VW16
Position
2
AA seq 361 aa AA seqDB search
MKALILVGGFGTRLRPLTLSFPKPLVDFANKPMILHQIEALKAVGVDEVVLAINYQPEVM
LNFLKDFETKLEIKITCSQETEPLGTAGPLALARDKLLDGSGEPFFVLNSDVISEYPLKE
MLEFHKSHGGEASIMVTKVDEPSKYGVVVMEESTGRVEKFVEKPKLYVGNKINAGIYLLN
PSVLDKIELRPTSIEKETFPKIAAAQGLYAMVLPGFWMDIGQPRDYITGLRLYLDSLRKK
SPAKLTSGPHIVGNVLVDETATIGEGCLIGPDVAIGPGCIVESGVRLSRCTVMRGVRIKK
HACISSSIIGWHSTVGQWARIENMTILGEDVHVSDEIYSNGGVVLPHKEIKSNILKPEIV
M
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcactcattcttgttggaggcttcggcactcgcttgagaccattgactctcagt
ttcccaaagccccttgttgattttgctaataaacccatgatccttcatcagatagaggct
cttaaggcagttggagttgatgaagtggttttggccatcaattatcagccagaggtgatg
ctgaacttcttgaaggactttgagaccaagctggaaatcaaaatcacttgctcacaagag
accgagccactaggtaccgctggtcctctggctctagcgagagacaaattgcttgatgga
tctggagagcccttctttgttcttaacagtgatgtgattagtgagtaccctcttaaagaa
atgcttgagtttcacaaatctcacggtggggaagcctccataatggtaacaaaggtggat
gaaccgtcgaaatatggagtggttgttatggaagaaagcactggaagagtggagaagttt
gtggaaaagccaaaactgtatgtaggtaacaagatcaacgctgggatttatcttctgaac
ccatctgttcttgataagattgagctaagaccgacttcaatcgaaaaagagactttccct
aagattgcagcagcgcaagggctctatgctatggtgctaccagggttttggatggacatt
gggcaaccccgtgactacataacgggtttgagactctacttagactcccttaggaagaaa
tctcctgccaaattaaccagtgggccacacatagttgggaatgttcttgttgacgaaacc
gctacaattggggaaggatgtttgattggaccagacgttgccattggtccaggctgcatt
gttgagtcaggagtcagactctcccgatgcacggtcatgcgtggagtccgcatcaagaag
catgcgtgtatctcgagcagtatcatcgggtggcactcaacggttggtcaatgggccagg
atcgagaacatgacgatcctcggtgaggatgttcatgtgagcgatgagatctatagcaat
ggaggagttgttttgccacacaaggagatcaaatcaaacatcttgaagccagagatagtg
atgtga

DBGET integrated database retrieval system