KEGG   Arabidopsis thaliana (thale cress): AT2G41630Help
Entry
AT2G41630         CDS       T00041                                 

Gene name
TFIIB
Definition
(RefSeq) transcription factor IIB
  KO
K03124  transcription initiation factor TFIIB
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath03022  Basal transcription factors
Brite
KEGG Orthology (KO) [BR:ath00001]
 09120 Genetic Information Processing
  09121 Transcription
   03022 Basal transcription factors
    AT2G41630 (TFIIB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:ath03021]
    AT2G41630 (TFIIB)
Transcription machinery [BR:ath03021]
 Eukaryotic type
  RNA polymerase II system
   Basal transcription factors
    TFIIB
     AT2G41630 (TFIIB)
 Prokaryotic type
  Archaeal type
    TFB
     AT2G41630 (TFIIB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TFIIB TF_Zn_Ribbon Cyclin_N HTH_5 Ribosomal_S27e Zn-ribbon_8 HTH_Tnp_ISL3
Motif
Other DBs
NCBI-GeneID: 818761
NCBI-ProteinID: NP_181694
MIPS: AT2G41630.1
TAIR: AT2G41630
Araport: AT2G41630
UniProt: P48512 A0A178VYM4
Position
2
AA seq 312 aa AA seqDB search
MSDAYCTDCKKETELVVDHSAGDTLCSECGLVLESHSIDETSEWRTFANESSNSDPNRVG
GPTNPLLADSALTTVIAKPNGSSGDFLSSSLGRWQNRNSNSDRGLIQAFKTIATMSERLG
LVATIKDRANELYKRLEDQKSSRGRNQDALYAACLYIACRQEDKPRTIKEICVIANGATK
KEIGRAKDYIVKTLGLEPGQSVDLGTIHAGDFMRRFCSNLAMSNHAVKAAQEAVQKSEEF
DIRRSPISIAAVVIYIITQLSDDKKTLKDISHATGVAEGTIRNSYKDLYPHLSKIAPSWY
AKEEDLKNLSSP
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgtcggatgcgtattgtacggattgtaaaaaggagacggagttggttgtcgatcactca
gccggagataccctttgctccgagtgtggtttggttttggaatctcactccattgatgag
acctctgagtggcgtaccttcgctaatgaatcttccaacagcgatcccaatcgtgtcggt
ggtccaaccaacccgcttctcgctgatagtgctttaaccactgttatcgctaagcccaat
ggttcatctggtgatttcttgtcttcttctctcgggaggtggcagaatcgtaactccaat
tccgatcgtggtttgattcaagcttttaaaaccattgctaccatgtctgaaaggttggga
cttgttgcaactatcaaggatcgggctaatgagttatataagaggctggaggatcagaag
tcaagcaggggaagaaatcaggatgcactttatgcagcctgtctgtacattgcttgtcgc
caagaggacaagccacgaactattaaggaaatatgcgttattgccaatggggcgacaaag
aaggaaattggccgagcaaaagactacattgttaagacattgggactggagcctggtcag
tctgtggatttaggaactatacacgctggtgatttcatgagaaggttctgctccaacctt
gcaatgtctaaccatgcggtgaaagctgctcaggaagctgtgcaaaaatctgaggaattt
gatataaggaggagtcctatatcaatagcagcagtagtcatctatatcataacccagctg
tctgatgacaagaagactctcaaagatatatcgcatgcgacaggagtagcagaagggaca
ataaggaattcatacaaagacttgtatccacatctgtcaaagatagcaccaagttggtat
gcaaaggaagaggatctgaaaaacctgtcaagtccttga

DBGET integrated database retrieval system