KEGG   Arabidopsis thaliana (thale cress): AT2G41880Help
Entry
AT2G41880         CDS       T00041                                 

Gene name
GK-1
Definition
(RefSeq) guanylate kinase 1
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00230  Purine metabolism
ath01100  Metabolic pathways
Module
ath_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    AT2G41880 (GK-1)
Enzymes [BR:ath01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     AT2G41880 (GK-1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_kin AAA_18 AAA_16 AAA_33 RsgA_GTPase T3SS_needle_E ABC_tran MMR_HSR1 Kelch_2 RNA_helicase AAA_22 Kelch_1 AAA_29 Rad17
Motif
Other DBs
NCBI-GeneID: 818788
NCBI-ProteinID: NP_001323632
MIPS: AT2G41880.1
TAIR: AT2G41880
Araport: AT2G41880
UniProt: P93757
Position
2
AA seq 387 aa AA seqDB search
MGEAPAVLVDHPENGHSNGVCVKSEPENTEITVDVGDRIFLIGGTHERNNFSIGVQIYDK
ISNNWFSPIVLGTGPKPSKGYSAFVLEQGRILVIKKGSPRNDSIWFLEVDSPYVREQKKL
LRKEVVAWSKGVRGNAEKPIVISGPSGVGKGTLISMLMKEFPSMFGFSVSHTTRSPRSME
MDGVHYHFADKKVMEKEIKDGKFLEFASVHGNLYGTSIESVEAVTDSGKRCILDIDVQGA
RSVRASSLDAIFIFVCPPSMKELEDRLRARGTETEEQIQKRLRNAEAEIKEGISSGIFGL
ILYNDNLEECYKKLKNLLGLDGLAHVNGVEIEGINLPIEYAVSKMEDKIIIQETGKETRN
KIVVDISSLNGGAPGRTRGILVDAIKF
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgggagaagctccagcagtattagtggatcatccggagaacggacactccaatggtgtc
tgtgtgaaatctgaaccagagaacactgagataacagtcgatgtcggcgatcgaatattt
ttgatcggtggaactcatgaaaggaacaatttttccattggggttcagatttatgacaaa
atcagtaacaactggtttagtcctattgtgcttgggacaggtcctaagcccagcaagggg
tactccgcgtttgttcttgaacaaggtcggattttggttattaaaaaaggttcacctcgc
aacgactccatctggttcctcgaggtcgatagtccttatgtgcgggaacagaagaagtta
ctaaggaaggaagttgttgcttggagtaaaggtgtgagaggcaatgctgagaagcctatt
gttataagcggtccttctggtgtgggcaaaggaacgcttatatcaatgcttatgaaggag
tttccttcaatgtttgggttctctgtgagtcacacaactcgatctccgaggtctatggag
atggacggtgttcattatcactttgctgataaaaaagttatggagaaagaaatcaaagac
ggaaagtttcttgagtttgcttctgttcacggtaatctctatggaaccagcattgagtcc
gttgaagcggtaacagattcaggaaagagatgtattctcgacattgatgttcagggggca
aggtctgtgagagcgagttctcttgatgccatattcatattcgtatgtcccccttcaatg
aaagagcttgaagatcggctccgtgctagaggaaccgagacagaggagcaaattcaaaag
cggcttagaaatgctgaggcagagatcaaagaagggatatcctcgggtattttcggtctc
attttgtataatgacaaccttgaggaatgctacaagaagctcaagaatctcttggggcta
gatggactcgctcatgtcaatggtgtagaaatagaggggatcaatcttcccattgagtac
gcagtatctaaaatggaagataagatcattattcaagaaacaggaaaagaaacaaggaat
aagattgtagtggatatatcttcgcttaatggaggagcaccgggtagaacaagggggatt
cttgtcgacgccattaagttctag

DBGET integrated database retrieval system