KEGG   Arabidopsis thaliana (thale cress): AT2G42520Help
Entry
AT2G42520         CDS       T00041                                 

Definition
(RefSeq) P-loop containing nucleoside triphosphate hydrolases superfamily protein
  KO
K11594  ATP-dependent RNA helicase DDX3X [EC:3.6.4.13]
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
KEGG Orthology (KO) [BR:ath00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ath03019]
    AT2G42520
   03041 Spliceosome [BR:ath03041]
    AT2G42520
   03036 Chromosome and associated proteins [BR:ath03036]
    AT2G42520
Enzymes [BR:ath01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     AT2G42520
Messenger RNA biogenesis [BR:ath03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     AT2G42520
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     AT2G42520
Spliceosome [BR:ath03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   RNA helicase-like proteins
    AT2G42520
Chromosome and associated proteins [BR:ath03036]
 Eukaryotic type
  Gene silencing
   RISC (RNA-induced silencing complex)
    AT2G42520
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DEAD Helicase_C ResIII NPF
Motif
Other DBs
NCBI-GeneID: 818852
NCBI-ProteinID: NP_001324554
MIPS: AT2G42520.1
TAIR: AT2G42520
Araport: AT2G42520
UniProt: Q84W89
Position
2
AA seq 633 aa AA seqDB search
MSASWADVADSENTGSGSSNQNSHPSRPAYVPPHLRNRPAASEPVAPLPANDRVGYGGPP
SGSRWAPGGSGVGVGGGGGYRADAGRPGSGSGYGGRGGGGWNNRSGGWDRREREVNPFEN
DDSEPEPAFTEQDNTVINFDAYEDIPIETSGDNVPPPVNTFAEIDLGEALNLNIRRCKYV
KPTPVQRHAIPILLEGRDLMACAQTGSGKTAAFCFPIISGIMKDQHVQRPRGSRTVYPLA
VILSPTRELASQIHDEAKKFSYQTGVKVVVAYGGTPINQQLRELERGVDILVATPGRLND
LLERARVSMQMIRFLALDEADRMLDMGFEPQIRKIVEQMDMPPRGVRQTLLFSATFPREI
QRLAADFLANYIFLAVGRVGSSTDLIVQRVEFVLDSDKRSHLMDLLHAQRENGIQGKQAL
TLVFVETKRGADSLENWLCINGFPATSIHGDRTQQEREVALKAFKSGRTPILVATDVAAR
GLDIPHVAHVVNFDLPNDIDDYVHRIGRTGRAGKSGLATAFFNDGNTSLARPLAELMQEA
NQEVPEWLTRYASRSSFGGGKNRRSGGRFGGRDFRREGSFGSGRGGYGGGGGGYGGGGGY
GGGGGYGGGGGYGGGYGGASSGGYGGEPPSAWD
NT seq 1902 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcatcatgggctgatgtagctgactcagagaacacgggttctgggtcttctaat
cagaattctcatccttcacgacctgcttatgttcctccacatctaaggaacaggccagca
gcttctgagcctgttgctccattgccagctaatgatcgtgtaggttatggtggtccacct
tctggctctcgatgggctcctggtggtagtggtgttggtgttggaggtggtggtggttat
agggctgatgcaggtcgtcctggctctggctctggctatggtggacgaggaggtggtggt
tggaacaacagaagcggagggtgggaccgtagggaacgtgaagtaaacccctttgaaaat
gatgattccgaaccagaaccagcttttactgagcaggataatacggttattaattttgat
gcctatgaagatattccgattgagaccagtggggataatgtgcctcctcctgttaacaca
ttcgcagagatagatctcggggaggcattgaatctaaatatccgtagatgcaaatatgtt
aagccaacacctgttcagcgtcatgcgattccgatattgcttgaagggagggatttgatg
gcctgtgctcagacagggtcggggaagacagctgctttttgctttccaatcattagtgga
ataatgaaagatcagcatgtacagagaccccgtggttcacgaacagtctaccctcttgca
gttattctctcaccaacaagagagttggcaagtcagatacatgatgaggctaaaaagttc
tcttaccaaactggtgtgaaggtggttgttgcatatggaggaacacctattaaccagcag
ctccgggaacttgagaggggagtcgatattcttgtggcaacgcctggtcgattaaatgat
ttgctcgagagagctagagtctcaatgcagatgattagatttttagctcttgatgaggcc
gatagaatgcttgacatgggttttgaaccacaaattagaaagattgtcgaacaaatggac
atgcctccacgtggagttagacagacactgttgtttagtgctacatttccaagagaaatt
cagagactcgcagctgacttcctagcaaattatatatttttggctgtgggtagagtgggt
tcaagtaccgatttaattgtccaaagggttgagtttgtccttgactctgacaaaagaagt
catctcatggacctgcttcacgctcagagagagaatggcatccaaggcaagcaagccctg
accttagtttttgtggagacaaagagaggagctgactctttggaaaattggttgtgcatc
aatgggtttccagcaacctccattcacggtgacagaacacagcaggaaagagaagtggca
ttgaaagccttcaagagtgggagaacaccgattttggttgcaactgatgtagcagcacgt
ggccttgacattccccacgtggctcatgtggtcaacttcgatctgccaaatgacattgat
gactatgtccaccgtattggacgaacaggacgtgctggcaaatcaggactagcaactgcc
ttcttcaacgatggcaacacctcactggccagaccgctcgctgagctgatgcaagaagct
aaccaagaagtccctgagtggctcactcggtatgcgtcacggtcctcttttggtggtggt
aagaaccggcggtctggtggtcgatttggtggccgtgactttagaagggaagggtctttc
ggtagcggtagaggaggctatggcggtggaggaggagggtatggcggcggaggaggctat
ggtggtggaggaggctatggcggcggaggaggctatggtggtggatatggtggtgcttca
agtggtggatatggtggagaacctccaagtgcttgggactaa

DBGET integrated database retrieval system