KEGG   Arabidopsis thaliana (thale cress): AT2G42590Help
Entry
AT2G42590         CDS       T00041                                 

Gene name
GRF9
Definition
(RefSeq) general regulatory factor 9
  KO
K06630  14-3-3 protein epsilon
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
KEGG Orthology (KO) [BR:ath00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ath03400]
    AT2G42590 (GRF9)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ath04147]
    AT2G42590 (GRF9)
DNA repair and recombination proteins [BR:ath03400]
 Eukaryotic Type
  Check point factors
   Other check point factors
    AT2G42590 (GRF9)
Exosome [BR:ath04147]
 Exosomal proteins
  Proteins found in most exosomes
   AT2G42590 (GRF9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 14-3-3 FlaF
Motif
Other DBs
NCBI-GeneID: 818859
NCBI-ProteinID: NP_565977
MIPS: AT2G42590.1
TAIR: AT2G42590
Araport: AT2G42590
UniProt: Q96299 A0A178VYW7
Position
2
AA seq 263 aa AA seqDB search
MGSGKERDTFVYLAKLSEQAERYEEMVESMKSVAKLNVDLTVEERNLLSVGYKNVIGSRR
ASWRIFSSIEQKEAVKGNDVNVKRIKEYMEKVELELSNICIDIMSVLDEHLIPSASEGES
TVFFNKMKGDYYRYLAEFKSGNERKEAADQSLKAYEIATTAAEAKLPPTHPIRLGLALNF
SVFYYEIMNAPERACHLAKQAFDEAISELDTLNEESYKDSTLIMQLLRDNLTLWTSDISE
EGGDDAHKTNGSAKPGAGGDDAE
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgggttctggaaaagagcgtgacactttcgtctacctcgctaagctctctgagcaagct
gagcgttatgaagaaatggtggaatcaatgaaaagtgttgcgaaattgaatgttgatctg
acggtggaagagaggaacttactctctgtgggttacaagaacgtgattggttcaaggaga
gcttcgtggaggatcttctcgtcgattgaacaaaaggaagcagtgaaagggaatgatgtt
aatgtaaagaggatcaaagagtatatggagaaggttgagttagagctttctaacatatgc
attgatattatgtctgtcttagatgagcatctcattccttcggcttccgagggtgaatct
actgtcttcttcaacaagatgaaaggtgactattaccgctatcttgctgagttcaaatca
gggaacgagaggaaagaggctgctgatcagtctttgaaagcctatgagattgctactact
gctgctgaggctaagctccctccaacacaccctatcagattgggtttggctttgaatttc
tctgtcttctactacgagatcatgaacgcacctgaaagggcatgtcaccttgctaagcag
gcgttcgatgaagctatctcagagcttgacactctgaacgaggaatcctacaaagatagc
accttaataatgcaactccttagggacaatctgaccttgtggacttctgacatctcagaa
gaaggaggagacgatgctcataagacgaatggttctgccaaacctggtgctggtggagac
gatgcagagtga

DBGET integrated database retrieval system